KEGG   Oryzias latipes (Japanese medaka): 101174648Help
Entry
101174648         CDS       T02443                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4 isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101174648
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101174648
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101174648
Protein kinases [BR:ola01001]
 Serine/threonine kinases: STE group
  STE20 family
   101174648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 101174648
NCBI-ProteinID: XP_023821699
Position
2
AA seq 1474 aa AA seqDB search
MANDSPAKSLVEIDLASLREPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNQLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIESCLVKNYMQRPPTDQLLKHPFIRDQPNERQVRI
QLKDHIDRTKKKRGEKDETEYEYSGSEDEEEDPPEQEGEPSSIINATESTLRRDFIRLQQ
ENKERSEAMRHQQLLQEQQMREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRCEREMRR
QQEREQRRREQEEKRRMEEMDRRRKEEEERRRAEDEKRRNDREQEYIRRQLEEEQRHLEK
LQEQLLREQAMLLEFKWRELDEQRKAERLHKRLQLEQVYLLSLQHESKQQHPADRTAPSS
EPSHTPQALTLPPAFLPTPRAQVIDAVVSLASEPPRVPQITPSDRTVPEKTDETSTRQIS
PSQTPQPSVSETPTDSKSPKAESLEPDRISEPVRLPIQPIREADERYRKNIQGSPQAAPP
PKQPPLPPRSSEPFSNGGSSSEAMHRPMEPQVQWSHLAALKSSNSATPSPPPPVVARSQS
FSESGGVASNFAQLHLRSQDPHHQHHHHPSPAFTDPHPQPPLHHPQAQNRLEHQSSSEEV
PPKVPVRTTSRSPVLSRRESPLPTQPNNQRNAVGNMEQRPLWDRVEKLQSRPGSGSSSNS
NSQASPGERFRPRCESPASSKSEGSPLQRPENLPKKQDERNVARPTRPADLTALAKELRA
VDDVRPPHKVTDYSSSSDDSGTTDEEDDEEVDQEPGDESTSGAEDSRAGRLRNGEADSAK
TMLVEDSESEQGTTPSKDGTLVIRQSTADIKRLVNVSSSSSSSSPGSGRGPPEKNGRMYH
LPDIIQQSHHSSPPSTASFSSLSSSSSSSFPSSSSQASLGVSSQISLEELVAVESQSESN
SMSKHKSSSSFTPFIDPRLLQISPSGGSSLNNMAVFGQEGRPADPLRSDPSRKGSVVNVN
PVNTRPPSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRR
RIQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWVNVGDLEGCVH
YKVVKYERIKFLVLALKNAVEVYAWAPKPYHKFMAFKSFGDLVHKPLLVDLTVEEGQRLK
VIYGSCSGFHAVDVDSGAVYDIYLPTHIQTSIQCHAIIILPNTDGIELLVCYEDEGVYVN
TYGRITKDVVLQWGEMPTSVAYIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKF
LCERNDKVFFASVRAGGASQVYFMTLGRSSLMSW
NT seq 4425 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgactccccagctaaaagtctggtagagatagacttggcttcattgcgggaa
ccagctgggatattcgagctggtggaggtggttggaaatggaacctatggacaagtctac
aaggggcgacatgtcaagactggacaactggctgccatcaaagttatggatgtcacagaa
gatgaggaggaggaaatcaaactggagatcaatatgctgaagaaatattcccaccacaga
aacatagccacctattatggagcttttatcaagaagagccccccgggtcacgatgaccag
ctgtggctggtaatggagttctgtggtgccggttcgatcacagatctggtgaagaacacg
aagggaaaccagctgaaggaagactggatcgcttacatctccagagagatcctcagaggc
cttgctcacctacacgcccaccacgtgatccaccgtgacattaaaggccagaacgttctg
ctgacagagaacgctgaagttaaactggtggacttcggcgtgagcgcccagctggatcgc
acagtggggcggagaaacaccttcatcgggactccatattggatggcgcctgaggtcatc
gcttgtgatgagaacccggatgcaacctatgattacagaagcgatctgtggtcttgcggc
atcacagccatcgaaatggccgaaggagcgccgcccctttgtgacatgcaccccatgcgt
gcgctcttcctcattccacgaaaccccccaccgaggctcaaatccaagaaatggtccaag
aagtttttcagcttcatcgagagctgtctggtgaagaattacatgcagcggccccccaca
gaccagctgctgaagcacccgttcatccgagaccagcccaacgagaggcaggtgcgcatc
cagctcaaggaccacatcgaccggaccaagaagaagaggggcgagaaagatgagacggag
tacgagtacagtggcagtgaggatgaggaggaggatcctccagagcaggaaggagaaccg
agctccatcatcaacgcaaccgagtccaccctgcgacgcgacttcatccgcctgcagcag
gagaacaaggagcgctccgaggccatgcgtcaccagcagctcctccaggagcagcagatg
cgggagcaagaggagtacaagcggcagctcctggcagagaggcagaagcgcatcgagcag
cagaaggagcagaggcggcggctggaggagcaacaacgatgcgaacgggaaatgaggagg
cagcaggagcgcgagcagcggcggcgcgagcaggaggagaaaagacgaatggaggagatg
gaccgcaggcgaaaagaggaagaggagcgcagacgcgccgaagacgaaaagagaaggaac
gatcgggagcaggagtacattagacggcagctggaggaggagcagcgacacctggagaag
ctgcaggagcagctgctgcgagagcaggccatgctgctggagttcaagtggcgggagctg
gacgagcagcgcaaagccgagagactgcataagcggctgcagctggagcaggtgtacctg
ctgtccctgcagcatgaatccaagcagcagcaccctgctgacaggacagccccctcctca
gagcccagccacactccccaggctttgactctgcccccggccttcttgccgaccccacgg
gctcaggtcatcgacgctgtcgtttctctggcctctgagccccccagagtcccccagatt
accccctcagacaggacagtgcctgagaagactgacgagaccagtaccagacagatttct
ccctcccaaaccccccagccctctgtaagcgaaacccccaccgactctaagagtcccaag
gcagaaagtctggagcctgacaggatctccgagcctgtcaggcttcccattcagcctatc
agagaggcggatgagcgctaccgtaaaaacatccagggctccccgcaggccgcccctcct
cccaagcagccccctctgccaccccgatcctccgaacccttctccaacggcggctcctcc
tctgaggccatgcaccggcccatggagcctcaggtccagtggtcacacctggccgctctt
aagagcagcaacagcgccaccccctctcctcctccgcctgttgtcgctcgctcccagtcc
ttcagcgaatccggtggcgtggcgtctaactttgcacaactccacctgcgctcccaggac
ccccaccatcaacaccaccaccacccatcgcctgcattcactgacccccacccccaacct
cccctccaccacccccaggctcagaataggctggaacaccagtccagcagtgaagaggtt
cctccaaaggtaccagtgaggacaacatccagatctccggttttgtcgcggcgagagtct
cctctgccaacgcagcccaacaaccagaggaacgccgtcgggaacatggagcagcgccct
ctatgggacagggtggagaagctgcagtcccgacccggcagcggcagctcctccaactcc
aactctcaggccagtcccggcgagcgtttcagacctcgctgtgagtcccctgcttcctct
aaatctgagggatcgcctctccagcggcccgaaaacctccccaaaaaacaggacgaaagg
aacgtggcccggccgacgcgacccgctgacctgacggcgctggctaaggagctgcgtgcc
gtggacgacgtgcggcccccccacaaggtcacagactactcctcatcgagcgatgactcg
ggcaccacggatgaggaagacgacgaggaggtggaccaggagccaggggacgagtccacg
tcgggggccgaggactccagagctgggaggctcagaaacggggaggcagactctgctaag
accatgctggtggaggactctgagagtgagcagggcaccaccccctccaaagacgggacc
ctggtcatcagacagagcacagctgacataaagcggttggtcaatgtctcgtcttcatca
tcctcctcctcgcccggctccggtcgtggccccccagagaaaaacggccgcatgtaccac
ctccccgacattattcagcagagccatcattcctcccccccctccacagccagcttctcc
tccttgtcctcctcctcctcctcctccttcccctcatcatctagccaggccagtcttggc
gtctcctcacagatctccttggaggagctcgtagccgtagagtcgcagtcagagagcaac
tccatgtccaaacacaagtcttcctcttcgttcactcccttcatcgacccacgcctcctc
cagatctctccatcaggcggcagctccctcaacaacatggcggtttttggacaagaaggc
cgacccgccgacccactgcgctctgacccctcccgtaaaggctcggtggtcaacgtcaac
cctgtcaacactcgtccgcccagcgacactcccgagatccgcaagtacaagaagaggttc
aactccgagattctgtgcgcggcgctctggggggtgaacctgctggtggggacagaaagc
gggctgatgctgctggaccggagcggtcagggtaaggtttacccgctgattaatcgacgc
cgcatccagcagatggatgtcctggagggactcaacgtcctggtaaccatatcaggtaaa
aagaacaaactgcgagtgtattacctgtcgtggctccgaaacaagattttgcacaacgac
ccagaagtggagaagaagcagggctgggtcaacgtgggcgacctggagggctgcgttcac
tacaaagtcgtaaagtacgagaggatcaagttcctggttctggctttgaagaacgctgtg
gaggtgtacgcctgggcgcccaaaccctaccacaagttcatggccttcaagtcgtttggt
gacctggtgcacaaacctctgctggtggacctgactgtggaggaaggccaaaggttaaag
gtcatctacggatcctgctcgggcttccacgctgtggatgtggactcgggcgccgtctac
gacatctacctccccacacatatccagaccagcatccagtgccacgccatcatcatccta
cccaacactgacggcatcgagctgctggtctgttacgaggacgagggcgtctacgtcaac
acgtacgggcgcatcaccaaagacgtggtgctgcagtggggagaaatgccgacttccgtg
gcctacattaggtcaaaccagatcatgggctggggcgaaaaggccatcgagatccgctcg
gtggagacgggacacctggacggcgtcttcatgcacaagcgagcccagagactcaaattc
ctctgtgaaagaaacgacaaggtctttttcgcctccgtgcgagccggaggcgccagtcaa
gtatacttcatgacgctgggacgctcttccctcatgagctggtga

DBGET integrated database retrieval system