KEGG   Oryzias latipes (Japanese medaka): 101175464Help
Entry
101175464         CDS       T02443                                 

Definition
(RefSeq) glutaminase kidney isoform, mitochondrial isoform X3
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00220  Arginine biosynthesis
ola00250  Alanine, aspartate and glutamate metabolism
ola00471  D-Glutamine and D-glutamate metabolism
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101175464
   00220 Arginine biosynthesis
    101175464
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101175464
Enzymes [BR:ola01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     101175464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase Ank_2 Ank_4 Ank_3 Ank_5 Ank
Motif
Other DBs
NCBI-GeneID: 101175464
NCBI-ProteinID: XP_011479803
Position
2
AA seq 487 aa AA seqDB search
MEMLKVTMKTTSDGTLDRHLFKKCVQSNIVLLTQAFRKKFVIPDFQPFCAHIDELYENAK
KMPGGQVADYIPQLARFSPDLWAVALCTVDGQRHTVGDTKVPFCLQSCVKPLKYAIAVHD
HGTDYVHRFIGKEPSGLRFNKLFLNEEDKPHNPMVNAGAIVCTSLIKQGASNAEKFDYMM
NFMNKLAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMTSILDFYFQLCS
IEVTCESASVMAATLANGGFCPITGERILSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLP
AKSGVAGGILLVVPNVMGIMCWSPPLDKLGNSVRGIQFCTDLVSLCNFHNYDNLRHFAKK
LDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSSMDMEQRDYDSRTALHVAAAEGHA
EVVRFLLEACKVNPVPKDRWGNTPMDEAVHFGHHDVVTILRDYHNQYSPQDSGAKKESAE
NKLDGML
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggagatgctgaaggtgacgatgaagaccacgtcagacggaacgctcgaccggcacctc
ttcaaaaagtgcgttcagagcaacatcgttctgctcactcaggccttcaggaagaagttt
gtcatcccggacttccagcctttctgcgcccacatcgacgaactctacgagaacgccaag
aaaatgcccggcggtcaggtggcggactacattccccagctggcccgcttcagtcccgat
ctgtgggccgtcgctctgtgcaccgtggatggacagaggcacacggtgggcgacaccaag
gtccccttctgcctgcagtcgtgcgtgaagccgctgaaatacgccatcgccgtgcacgac
cacggcaccgactacgtccaccgcttcatcggcaaggagcccagcggcctgaggttcaac
aagctcttcctgaacgaggaagataaaccccacaaccccatggtgaacgccggcgccatc
gtctgcacgtcactcatcaagcaaggagccagcaacgccgagaagtttgactatatgatg
aacttcatgaacaaactggcgggaaacgagtacgttggtttcagcaacgccacattccag
tcggagcgcgagtctggagacagaaacttcgccattggctactacctgaaggagaagaag
tgttttccagaaggaacagacatgacctccatcctggacttctactttcagctttgctcc
atagaggtgacctgtgagagcgccagtgtcatggcggcgacgctggccaacggcgggttc
tgtccaatcacaggcgagcgcatcctgagccccgaggcggtccgaaacactctgagtctg
atgcactcctgcgggatgtacgatttctcgggacagttcgctttccacgtcggcctgccg
gcgaaatcaggagtggccggtgggattctgctggtcgttcccaacgtgatgggcatcatg
tgctggtcccccccgctggataagttgggcaacagcgtgagaggcatccagttctgcacg
gatctggtttctctctgtaacttccacaactacgataatctccggcactttgcaaagaaa
ctggatcctcgtagggagggaggagaccagagggtgaagtccgtcatcaacctgctgttt
gccgcgtacacgggagacgtgtcggctttgaggaggttcgcgctgtcctccatggacatg
gagcagagggactacgactcccggacggcgctgcacgtggccgcagccgaaggacacgct
gaggtggtccgcttcctgctggaggcctgtaaagtcaacccggttcccaaggacaggtgg
gggaacacgccgatggatgaggctgtgcactttggccaccacgacgtggtcaccatcctc
cgcgactatcacaaccagtacagcccgcaggacagcggcgcgaagaaggaaagcgcggag
aataagctggacgggatgctgtga

DBGET integrated database retrieval system