KEGG   Oryzias latipes (Japanese medaka): 105354854
Entry
105354854         CDS       T02443                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04080  Neuroactive ligand-receptor interaction
ola04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    105354854 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    105354854 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 105354854
NCBI-ProteinID: XP_020562099
Position
10
AA seq 77 aa
MNVKILTLVIVLLVSLLCSAGAGPMASTEHGKDLGETATVKKMVQQNPARGGQPQRPAGW
KRRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc
ggtgctggtcctatggcctccacggagcatggcaaagacctgggagaaacagctactgtg
aaaaaaatggttcagcaaaatccagcgagaggcggccagccccaaagaccagctggttgg
aagagaagacgcccacggccccgtctctcccacaaggggccaatgccattctag

DBGET integrated database retrieval system