KEGG   Oryzias latipes (Japanese medaka): 111947723Help
Entry
111947723         CDS       T02443                                 

Definition
(RefSeq) heat shock 70 kDa protein 1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03040  Spliceosome
ola04010  MAPK signaling pathway
ola04141  Protein processing in endoplasmic reticulum
ola04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111947723
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111947723
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111947723
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111947723
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ola01009]
    111947723
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ola03041]
    111947723
   03009 Ribosome biogenesis [BR:ola03009]
    111947723
   03110 Chaperones and folding catalysts [BR:ola03110]
    111947723
   04131 Membrane trafficking [BR:ola04131]
    111947723
   03051 Proteasome [BR:ola03051]
    111947723
   03029 Mitochondrial biogenesis [BR:ola03029]
    111947723
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    111947723
Protein phosphatases and associated proteins [BR:ola01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     111947723
Spliceosome [BR:ola03041]
 Complex B
  Other components
   Prp19 complex
    111947723
 Complex C
   Prp19-CDC5 complex
    111947723
Ribosome biogenesis [BR:ola03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    111947723
Chaperones and folding catalysts [BR:ola03110]
 Heat shock proteins
  HSP70 / DNAK
   111947723
Membrane trafficking [BR:ola04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    111947723
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    111947723
Proteasome [BR:ola03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111947723
Mitochondrial biogenesis [BR:ola03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    111947723
Exosome [BR:ola04147]
 Exosomal proteins
  Proteins found in most exosomes
   111947723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A MetOD2
Motif
Other DBs
NCBI-GeneID: 111947723
NCBI-ProteinID: XP_023812999
Position
8
AA seq 639 aa AA seqDB search
MSAAKSVSIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VALNPSNTVFDAKRLIGRRFDEPVVQADMKHWPFKVVSEGGKPKIQVDYKGENKTFFPEE
ISSMVLVKMKEIAEAYLGHKVSNAVITVPAYFNDSQRQATKDAGVIAGLNVQRIINEPTA
AAIAYGLDKGKSGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMV
NHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTSVT
RARFEELCSDLFRGTLEPVEKALRDAKMDKGQIHDVVLVGGSTRIPKIQKLLQDFFNGRE
LNKSINPDEAVAYGAAVQAAILSGDTSGNVQDLLLLDVAPLSLGIETAGGVMTALIKRNT
TIPTKQTQVFSTYADNQPGVLIQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTF
DIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEQQRDKIAA
KNSLESLAFNLKSSAQDDSLKDKISQEDRKRVVEKCDETIAWLENNQLADKDEFQHKQKE
LEKVCNPIISKLYQGGMPSGSCREQARADSQGPTIEEVD
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggccaagagcgtgtccatcggcatcgacctgggcaccacctactcttgtgtg
ggcgtcttccagcacggaaaagtggaaatcatcgccaacgaccagggcaacaggaccacc
cccagctatgtggccttcaccgacacggagaggctgattggagacgcggccaagaaccag
gtggctctgaaccccagcaacaccgtgtttgacgccaagaggctgattgggcggaggttc
gacgagccggtggtgcaggccgacatgaagcactggcccttcaaggtggtttcagaagga
gggaagcccaaaatccaggtggactacaaaggagagaacaagaccttcttccccgaggag
atttcctccatggtcctggtgaagatgaaggagatcgccgaggcctacctgggccacaag
gtgtccaacgccgtcatcacagtgccggcgtacttcaacgactcccaacgacaggccacc
aaagacgcgggcgtcatcgcgggactcaacgtccagaggatcatcaacgagcccacggcg
gccgccatcgcctacggactggacaagggcaagtcgggagagagaaacgtgctgatcttt
gacttgggaggaggcaccttcgacgtgtccatcctgaccatcgaagacggcatctttgag
gtgaaggccacggccggagacactcacctgggcggagaggactttgacaaccgcatggtc
aaccactttgtggaggagttcaagaggaaacacaagaaggacatcagccagaacaagagg
gccttgaggaggctgcgcaccgcttgcgagagggccaagaggaccctgtcctccagctcc
caggccagcatcgagatcgactctctgtttgagggcatcgacttctacacctccgtcacc
agagctcgctttgaggagctgtgctccgacctgttcaggggaacgctggaaccggtggag
aaagccctgagggacgccaagatggacaaggggcagatccacgacgtggtcctggtggga
ggctccacccggatccccaaaatccagaagctcctgcaggacttcttcaacggccgagag
ctgaacaagagcatcaacccggacgaggcggtggcttacggcgccgccgtgcaggccgcc
atcctgtcgggcgacacctcgggcaacgtccaggacctgctgctgctggacgtggcgcct
ctgtccctgggcatcgagacggccggtggagtcatgacggccctgatcaaacgcaacacc
accatccccaccaagcagacccaggtgttcagcacctacgccgacaaccagcccggggtc
ctgatccaggtctacgaaggcgagagagccatgaccaaggacaacaacctgctgggcaag
tttgatctgacgggaatcccgccggctcccagaggggtcccgcagatcgaggtcaccttc
gacatcgacgccaacggcatcttgaacgtgtcggcggtggacaaaagcaccggcaaggag
aacaagatcaccatcaccaacgacaagggccgcctcagcaaagaggacatcgagaggatg
gtgcaggaggcggagaagtacaaagccgaggacgagcagcagagggacaagatcgccgcc
aagaactccctggagtccttggccttcaacctgaagagcagcgcgcaggacgacagcttg
aaggacaaaatcagccaggaagacaggaagagggtggtggagaagtgcgacgagaccatc
gcctggctggagaacaaccagctggccgacaaagacgagttccagcacaagcagaaagag
ctggagaaggtctgcaaccccatcatcagcaagctgtatcagggagggatgcccagcggc
tcctgcagagagcaggcgcgggccgacagccaggggcccactattgaggaggtggactga

DBGET integrated database retrieval system