KEGG   Olleya sp. Bg11-27: CW732_06995Help
Entry
CW732_06995       CDS       T05214                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
oll  Olleya sp. Bg11-27
Pathway
oll00360  Phenylalanine metabolism
oll00400  Phenylalanine, tyrosine and tryptophan biosynthesis
oll00790  Folate biosynthesis
oll01100  Metabolic pathways
oll01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:oll00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CW732_06995
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CW732_06995
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CW732_06995
Enzymes [BR:oll01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     CW732_06995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H MIX
Motif
Other DBs
NCBI-ProteinID: AUC75436
UniProt: A0A2K8WXY9
Position
complement(1596708..1598468)
Genome map
AA seq 586 aa AA seqDB search
MAFKNIESNPILDRLPKHLRQFIKPQDYEDYSAIDQAVWRYAMRKNVDYLSMVAHSTYLE
GLQQTGISVDAIPNMYGMNRILKAIGWAAVAVDGFIPPNAFMEFQAYNVLVIASDIRQLE
HIEYTPAPDIIHEGAGHAPIIANPEYAEYLRRFGEIGCKAISSAKDYELYEAVRHLSIIK
EAPNTPQDQIDLAEKTVEDLQNNMGEPSEMALIRNLHWWTVEYGLIGSIENPKIYGAGLL
SSIGESAWCMTDKVKKLPYTIESTFQNFDITKPQPQLYVTPDFAHLSLVLESFANTMALR
TGGPSAIKKLIHSQALGTIELSTGLQISGVFTNMIEHNGKVSYIQTTGKTALANRDKELV
GHSTLEHADGFGSPIGKLKGINLAIEDMSPRDLRAYDIYEGETVTLEFENDIIVTGEIIT
GTRNLQGKIILISFKNCTVTHKDTILFEPDWGQYDMAVGKEVLSGYSGPADLHSFDLITH
KISSTTIHIEHSAEKLELIDLYKQVRDYREGTNCTISRTKVLEQLINRFPMDWLLPIELF
ELAKKGNENELCHTILEHLETIKQNRPEVGHLIDDGIKIASQEIAV
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttaaaaatatagagtctaatccaattttggatcgtttacctaagcatttaaga
cagtttattaagcctcaggattatgaggattattctgcaattgaccaagcggtttggcgt
tatgccatgcgtaaaaatgtcgattatttaagtatggtagcacatagcacctatttagaa
ggactacaacagacaggaattagtgttgatgctatcccaaatatgtatgggatgaatcgt
attttaaaagcgattggttgggctgctgttgctgttgatggctttataccgcctaatgct
tttatggagtttcaagcttataatgtattagttattgctagtgatattagacaattagaa
catatagaatatacacctgcgccagatattatccatgaaggtgctggtcacgctccaatt
attgctaatcctgaatatgctgagtatttaagacgttttggagaaattggttgtaaagcg
attagttctgctaaggattatgaattatacgaagctgtacgccacctatctattataaaa
gaagctcctaatacgccacaagatcaaatcgatttagcagaaaaaacggttgaagactta
caaaataatatgggtgaaccaagtgagatggctttaattagaaacttacactggtggacg
gttgaatatggtttgattggcagcattgaaaatcctaaaatttatggtgctggtttacta
tcatctattggagagagcgcttggtgtatgacggataaggtcaaaaaattaccttatacg
attgagtctacctttcagaattttgacattacaaaaccacaacctcaattatatgtgact
ccagattttgcacaccttagtttggtattagagtcttttgctaatactatggcactccgt
actggtggacctagtgctattaaaaaattaatacacagtcaagctttaggtactattgag
cttagtactggtttgcagatttcgggtgtgtttactaatatgattgaacataatggtaaa
gtaagctatatacagaccacaggaaaaacagcgttagctaaccgagataaagaattggtt
ggacacagtactttagaacatgcggatggttttggatctcctatcgggaaattaaaaggt
attaatttagctattgaagacatgtcgccacgtgatttacgtgcttatgatatttatgaa
ggtgaaacggtgactttagagtttgaaaatgatattattgttaccggagagattattacg
ggaacaagaaacctacaaggtaaaattatcttgattagttttaaaaactgtaccgtaaca
cataaagacactattttatttgaacctgactggggacaatatgacatggctgttggtaaa
gaagtgttatctgggtattctggccctgcagatttacatagttttgatttaattacgcat
aaaataagcagcacaacaatacatattgaacattctgctgaaaaattagaattgattgac
ctatacaaacaagtccgtgattatcgagaaggaactaactgtactatttctagaacaaaa
gtattggaacagttaattaaccgctttccgatggattggttattacctatcgaattgttt
gaattagcaaaaaaaggcaatgaaaatgagctgtgtcatactattcttgagcatttagaa
actatcaaacaaaacagacctgaagttgggcatttaattgatgatggtattaagattgca
agccaagagattgcagtttaa

DBGET integrated database retrieval system