KEGG   Olleya sp. Bg11-27: CW732_10090Help
Entry
CW732_10090       CDS       T05214                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
oll  Olleya sp. Bg11-27
Pathway
oll00480  Glutathione metabolism
oll00590  Arachidonic acid metabolism
oll01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oll00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CW732_10090
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CW732_10090
Enzymes [BR:oll01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CW732_10090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AUC75991
UniProt: A0A2K8WZA3
Position
complement(2260863..2261405)
Genome map
AA seq 180 aa AA seqDB search
MNPFKAFIATLFSKNTVAIDLNTLPSIYDITINNLQGKPIDLKTFKGKHILFVNVASKCG
FTPQYKALQELQENYSETLTVIGVPCNQFGSQEPGNADAIEVFCEVNYGVSFLITEKIDV
KGKQQHPLYAWLTKASKNGKSSSSVKWNFQKYMVSPDGKLLDYFYSTTTPNSSKIIKYLK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatttaaagcctttattgctaccctattctctaaaaacaccgttgccatagat
ttgaatacgctaccaagtatttatgatattacgattaataacttacaaggtaaacctatc
gatttaaaaacctttaaaggaaaacatatactatttgttaatgtggcttcaaaatgtgga
tttacaccacaatataaagcactacaagagttacaagaaaactatagcgagacactaaca
gtcattggtgtgccttgtaatcaatttggaagtcaagaacctggtaatgcagatgctatt
gaagtcttttgtgaggtcaattatggggtctcctttttaattacagaaaaaatagatgtt
aaaggaaaacaacaacaccctttgtatgcttggttaactaaagctagcaaaaatggtaaa
agtagttcttctgtaaaatggaatttccaaaagtatatggttagtccagacggtaaacta
ttagactacttctactctactacaacgcctaatagttctaaaattattaaatatttaaaa
tga

DBGET integrated database retrieval system