KEGG   Olsenella sp. oral taxon 807: ADJ70_12365Help
Entry
ADJ70_12365       CDS       T04016                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
olo  Olsenella sp. oral taxon 807
Pathway
olo00860  Porphyrin and chlorophyll metabolism
olo00970  Aminoacyl-tRNA biosynthesis
olo01100  Metabolic pathways
olo01110  Biosynthesis of secondary metabolites
olo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:olo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ADJ70_12365
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ADJ70_12365
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:olo01007]
    ADJ70_12365
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:olo03016]
    ADJ70_12365
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:olo02048]
    ADJ70_12365
Enzymes [BR:olo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     ADJ70_12365
Amino acid related enzymes [BR:olo01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   ADJ70_12365
Transfer RNA biogenesis [BR:olo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ADJ70_12365
 Prokaryotic type
   Other AARSs
    ADJ70_12365
Prokaryotic defense system [BR:olo02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    ADJ70_12365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AKT49541
UniProt: A0A0K1F4R8
Position
complement(1251026..1252537)
Genome map
AA seq 503 aa AA seqDB search
MTLNSPDIADTVRVRFAPSPTGKLHVGGARTAIYNWAFARANHGSFILRIDDTDPARSTE
ENTQVILRALRWLGLDWDEGPEVGGDWGPYWQARRLDIYRDVARRLIREGRAYYCFCTPE
RLAADRKAAEERHDPFQGYQRTCRSIDPAEAQRRVDAGEPHTIRIKVPDGRGDVVIRDVV
HGDVTFNARELDDFIIVRTDGTPTYNFTTVVDDATMGITHVIRGDDHLSNTPRQVIVYEA
MGVPTPTFAHISMILGPDGKKLSKRHGATSVEEYRDRGYDADAFVNYLALLGWAPDGTTT
IVSRDALAREFSLDRVSKNPATFDVKKLDWIQGQYLQAMSNEMFSKRVLIPELIRAGLEE
GSVEEAYARRPSWFGLLASLLRPRTTLAPEVVAKARFLYEGNNVTLDEKSVKKNLAKEGA
RASLEAAREALTSITTGAWTTAAIDAALEPLPERLDTSKRAFYGALRVAVCGNAVSPPLG
ESLELLGRDTTLARLARALPLAG
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgaattcacctgatattgctgataccgtgcgcgttcgcttcgcgccctcgcct
accggtaagcttcacgtgggcggcgcccgtaccgcgatctataactgggccttcgcgcgc
gcgaaccatggtagctttatcctgcgcatcgatgacaccgatcccgcccgctcgaccgag
gagaacacccaagtcatcctgcgcgccctgcgctggctggggctcgactgggacgagggt
cccgaggtcggtggcgactggggcccctactggcaggcacgacgccttgacatctaccgt
gatgtcgcacgtcgcctcatcagggagggcagggcgtactactgcttctgcacccccgag
aggcttgcagcagacagaaaggctgccgaggagcgtcacgacccctttcagggctatcag
cgcacctgcaggagcatagatcctgccgaggcgcagaggcgcgtcgacgccggggaaccc
cataccatccgcatcaaggttccggacgggcgcggtgacgtcgtcatccgtgacgtggtt
cacggcgacgtgaccttcaacgcccgcgagctcgacgatttcatcatcgtccgtacggac
ggcacgcccacctacaacttcacgaccgtggtcgatgatgccacgatggggataacccac
gtcattcgtggagacgaccacctctcgaacacgccacgccaagtcattgtctacgaggcg
atgggtgtgcccacacccacgttcgcgcacatctcgatgatcctgggaccggacggtaag
aagctctcgaagcgccatggcgcgacctccgtcgaggagtaccgggaccggggctatgat
gccgatgccttcgtgaattacctcgctctgctcggctgggcacctgatggcacgaccacg
atcgtctcgcgcgacgcgttggcacgcgagttctcgctcgatcgcgtgtcaaagaaccct
gcgaccttcgacgtcaagaagcttgactggattcagggtcagtacctacaggccatgagc
aacgagatgttctccaagagggtgctcatacccgaactcatcagggctggcctcgaggaa
ggtagcgtcgaggaggcctatgccaggcgtccctcgtggtttggcctgctcgcctctctg
ctgaggccgcgcacgacgctcgctccagaagtcgtcgcgaaggctcgcttcctctacgag
gggaacaatgtgaccctcgacgaaaagtccgtgaagaagaaccttgccaaggagggggcg
agagcgagccttgaggccgcacgagaggcactcacgtccatcaccacaggtgcctggact
accgctgccatcgacgccgccctagagccgcttcccgagaggctcgacaccagcaagcgt
gcattctacggtgccctgcgtgttgcggtgtgcggcaacgcggtctcgcccccgcttggc
gagtcactcgagctcctcggtcgagacaccacgcttgcgcgcctagcgagggcgcttccg
ctcgctgggtga

DBGET integrated database retrieval system