KEGG   Olsenella uli: Olsu_0802Help
Entry
Olsu_0802         CDS       T01285                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ols  Olsenella uli
Pathway
ols00010  Glycolysis / Gluconeogenesis
ols00071  Fatty acid degradation
ols00350  Tyrosine metabolism
ols00620  Pyruvate metabolism
ols00625  Chloroalkane and chloroalkene degradation
ols00626  Naphthalene degradation
ols00650  Butanoate metabolism
ols01100  Metabolic pathways
ols01110  Biosynthesis of secondary metabolites
ols01120  Microbial metabolism in diverse environments
ols01130  Biosynthesis of antibiotics
ols01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Olsu_0802
   00620 Pyruvate metabolism
    Olsu_0802
   00650 Butanoate metabolism
    Olsu_0802
  Lipid metabolism
   00071 Fatty acid degradation
    Olsu_0802
  Amino acid metabolism
   00350 Tyrosine metabolism
    Olsu_0802
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Olsu_0802
   00626 Naphthalene degradation
    Olsu_0802
Enzymes [BR:ols01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Olsu_0802
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Olsu_0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 Tox-SHH
Motif
Other DBs
NCBI-ProteinID: ADK67915
UniProt: E1QZV1
Position
911733..914354
Genome map
AA seq 873 aa AA seqDB search
MAKAEKVIDSVDALTERITAMRAAQAEFATFSQEQVDRIFYAAAMAADKARIPLAKLAVE
ETQMGLVEDKVIKNHYASEYIYNKYKSMRTCGVIEEDKAFGFKKIAEPIGIVAAVIPTTN
PTSTAIFKSLICLKTRNAIIISPHPRAKQCTIEAARVVRDAAEAAGLPKNIISWIDVPSL
ALTNELMHSCDTILATGGPGMVTAAYSSGKPALGVGPGNNPAIIDDSADVELSVNSIIHS
KTFDYGMICATEQNVIVLDKVYDAVKAEFQKRGCYFLKKDEAEKVVNLVIQESGAVNAAM
VGKSASWIAEQAGVSVPRSTKVLIGETSSVDPSNRWAHEKLTTILGMYRAKDFDDAIAKA
SKLIADGGYGHTSSLFCDVNETEKLARHAQAMKTCRILVNTPAAQGGIGDIYNFMMTPSL
TLGCGSWGGNSVCGNVGAANLINIKSVAERRENMLWLRTPEKVYFKKGCMPVALRELSEV
YGKKRCFVVTDQFLYKNGFTKKVEESLDEQGIFHSSFWNVEPDPSLQSALEGLEQMRAFE
PDCIIAMGGGSAMDCGKIMWSLYENPDEKFEDMSADFMDIRKRVYTFPKMGKKAFFVAIP
TSSGTGSEVTPFAIITDKTTGVKWPITDYELMPNMAIVDTDNMMTQPKGLTSASGVDVLT
HCLEAYVSVMASDYTDPMALQGMQLVFDYLPRAYDNPNDIEARDHMANASCLGGLAFANA
FLGMNHSMAHKLGAFHHIPHGWANAVILTRVMRYNSAERPTRMGTFPQYDHPKTLQRYAQ
AARFCGVTGKDDAEVFEKFVAKIGELFDYVGVKHTIAEYGVDEKYFLDSLDAMTEQAFND
QCTGANPRYPLMSEMKELYLDAYYGREASTYED
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggccgagaaagtcattgacagcgtcgacgccctcacggagcgaatcaccgcg
atgcgcgccgcgcaggctgagttcgccacgttcagccaggagcaggttgacaggatcttc
tacgccgcggccatggccgcagacaaggctcgcatccccctcgcgaagcttgccgtcgag
gagacccagatgggcctcgtcgaggacaaggtcatcaagaaccactacgcctccgagtac
atctacaacaagtacaagagcatgaggacctgtggcgtcatcgaggaggacaaggccttc
ggcttcaagaagatagccgagcccatcggcatcgtcgcggccgtcatccccaccaccaac
cccacctcgacggccatcttcaagtcgctcatctgcctgaagacgcgcaacgccatcatc
atcagcccacacccgcgtgccaagcagtgcaccatcgaggccgcgcgcgtcgtgcgcgac
gccgccgaggcggccggcctgcccaagaacatcatcagctggatcgacgtgccctcgctc
gccctcaccaatgagctcatgcactcctgcgacaccatcctcgccaccggcggccccggc
atggtgactgccgcctacagctccggtaagcccgcattgggcgtcggaccgggcaacaat
cccgccatcatcgacgattctgcggacgtcgagctctccgtcaactcgatcatccactcc
aagaccttcgactacggcatgatctgcgccaccgagcagaacgtcatcgtcctggacaag
gtctatgacgccgtcaaggccgagttccagaagcgcggctgctacttcctgaagaaggac
gaggccgagaaggtcgtcaacctggtcatccaggagtcaggcgccgtcaacgccgccatg
gtcggaaagagcgcctcctggatcgccgagcaggccggtgtcagcgtgcccaggtccacg
aaggtcctcatcggcgagacctcgtccgtcgacccctccaaccgttgggctcacgagaag
ctgaccaccatcctgggcatgtaccgtgccaaggacttcgatgacgccattgccaaggca
agcaagctcatcgccgatggcggctacggccacaccagctccctcttctgcgacgtcaac
gagaccgagaagctcgcgcgccacgcccaggccatgaagacctgccgcatcctggtcaac
accccggctgcgcagggcggcatcggcgacatctacaacttcatgatgaccccgtcgctc
accttgggttgtggctcctggggcggtaactccgtctgcggcaacgtgggtgccgccaac
ctcatcaacatcaagagcgtggctgagaggcgtgagaacatgctgtggctccgtacccct
gagaaggtctacttcaagaagggctgcatgcccgtcgccctgcgcgagctctccgaggtc
tacggcaagaagcgctgcttcgtcgtcaccgaccagttcctctacaagaacggttttacc
aagaaggtcgaggagtccctggacgagcaggggatcttccactccagcttctggaacgtc
gagcccgacccctccctgcagtccgccctcgagggcctcgagcagatgagggccttcgag
cccgactgcatcatcgccatgggtggtggctccgccatggactgcggcaagatcatgtgg
tccctctatgagaaccccgacgagaagttcgaggacatgtccgccgacttcatggacatc
cgcaagcgcgtctacaccttccccaagatgggcaagaaggccttcttcgtcgccatcccg
acctcctcgggcactggctccgaggtcacgccgttcgccatcatcacggacaagaccacg
ggggtgaagtggcccatcacggactacgagctcatgcccaacatggccatcgtcgacacc
gacaacatgatgacccagcccaagggcctgacctccgcctccggcgttgacgtcctgacg
cactgcctcgaggcctatgtctcggtcatggcctcggactacaccgatcccatggcactg
cagggcatgcagctcgtcttcgactacctgccccgcgcctacgacaatcccaacgacatc
gaggcccgcgaccacatggccaacgcctcctgccttggcggccttgccttcgccaacgcc
ttcctgggcatgaaccactccatggcccacaagctcggcgccttccatcacatcccccat
ggctgggccaatgccgtcatcctcacgcgcgtcatgcgctacaactctgcggagcggccg
acccgcatgggcaccttcccgcagtacgaccaccccaagacgctgcagcgctatgcgcag
gccgcccgcttctgcggtgtcaccggcaaggacgatgccgaggtgttcgagaagttcgtc
gccaagatcggcgaactctttgactacgtgggcgtcaagcacacgatcgccgagtacggg
gtcgacgagaagtacttcctcgacagcctcgatgcgatgaccgagcaggcattcaacgac
caatgcaccggcgccaacccgcgctaccccctcatgagcgagatgaaggagctctacctc
gatgcctactatggccgcgaggcaagtacctacgaggactag

DBGET integrated database retrieval system