KEGG   Olsenella uli: Olsu_0868Help
Entry
Olsu_0868         CDS       T01285                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ols  Olsenella uli
Pathway
ols00330  Arginine and proline metabolism
ols00332  Carbapenem biosynthesis
ols01100  Metabolic pathways
ols01130  Biosynthesis of antibiotics
ols01230  Biosynthesis of amino acids
Module
ols_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Olsu_0868
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Olsu_0868
Enzymes [BR:ols01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Olsu_0868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ADK67980
UniProt: E1R016
Position
988865..989989
Genome map
AA seq 374 aa AA seqDB search
MGEIFDAPGIIVVKVGSSTLVDAQGSPDRDFIAGLCAQVAQLRGEGHGVAVVSSGAVAAG
MERLGMDVRPLDMPGLQACASAGQAALTEVYADILSAYHIPCGQVLLTRRDLVDRKGYLN
ARNTLGRLLSLGAVPVVNENDTVSVAEFAFGDNDTLGAIVATLINADLYVILSDVDGLYT
ANPQSDPEARLVSRVEAITPEVAAMATGAGSAVGTGGMAAKVRAARAALSAGIPTVICRG
RRAGSLLEAAHGEGVGTRFEPSDGSAPESARKLWIGLAEVPHGTIWLDEGACTAVASRGA
SVLPVGVTRVEGDYAAGDVVNVMAPDGVLVGRGITRYSSEEMVRVHGLKLDVIARFMPEK
DGAVAIHRDELLVF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagattttcgatgcgcccggcatcatcgtcgtcaaggtcggttcctccaccctg
gtggatgcccagggctctcccgacagggacttcatcgctggcctctgcgcccaggtggcg
cagctgcggggcgaggggcacggcgtcgccgtcgtgtcgtccggtgccgtcgccgctggc
atggaacgtctgggcatggatgtgcggcccctcgacatgccggggctccaggcgtgcgcc
tcggccgggcaggcggctctcacggaggtctacgccgacatcctgagtgcctaccacatc
ccctgcggccaggtcctgctcacccgcagggacctcgtcgatcgcaagggatacctcaac
gcacgcaacactctcggtcggctgctgagcctgggtgccgttccggtcgtgaacgagaac
gacaccgtgtccgtcgccgagtttgccttcggggataacgacaccttgggtgccatcgtg
gcgactctcatcaacgcggacctctacgtcatcctctctgacgtcgacgggctctacacg
gcaaacccccagagcgaccccgaggcgcgcctcgtgtcgcgcgtcgaggccatcacgccc
gaggttgcggccatggcgacgggggcgggttctgccgttgggaccggcggcatggccgcg
aaggtccgtgctgcccgcgcggcactctccgccggcatacccaccgtcatctgtcggggc
cgaagggcagggtccctgcttgaggccgcacacggtgagggcgtgggaacgcgcttcgag
ccctcggacggaagcgcgcccgagagtgcccgcaagctctggatcgggcttgccgaggtt
ccgcatggcacgatatggctcgatgagggggcctgcaccgcggtggcctctcgaggggcc
tccgttctgcccgtgggcgtcacgcgcgtcgagggcgactatgcggccggtgacgttgtg
aacgtcatggcccccgacggcgtgctggtcggtcgtgggatcacgcgctactcaagcgag
gagatggtacgggtccacggcctcaagctcgacgtgatagcccgcttcatgcctgagaag
gacggcgccgtcgccatccaccgtgacgagctcctcgtcttctag

DBGET integrated database retrieval system