KEGG   Ostreococcus lucimarinus: OSTLU_119495Help
Entry
OSTLU_119495      CDS       T01029                                 

Gene name
chlI
Definition
(RefSeq) Magnesium-protoporyphyrin IX chelatase subunit ChlI
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00860  Porphyrin and chlorophyll metabolism
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OSTLU_119495 (chlI)
Enzymes [BR:olu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     OSTLU_119495 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase MCM AAA_5 Sigma54_activat AAA_22 AAA_16 AAA DUF815 AAA_29 RNA_helicase
Motif
Other DBs
NCBI-GeneID: 5000074
NCBI-ProteinID: XP_001416388
JGI: 119495
UniProt: A4RT28
Position
2:complement(join(440098..441167,441223..441278,441330..441357,441571..441610))
Genome map
AA seq 397 aa AA seqDB search
MSAAVSYSHQHVNALCRWSRGYKNIQGTRGCRVQQTLRPKAVSNDSEVEDSTARPVYPFC
AIIGQEEMKFAALMNIIDPNIGGIMVMGDRGTGKSTTVRSLTDLLPYIEIVKDDPFMSSP
TDPNLMSPDVLSAYRAKQPLETSFVPINMVDLPLGATEDRVCGTIDIEKALTEGTKAFEP
GLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVEREGISICHPARFILIGSGNPE
EGELRPQLLDRFGMHAQIKTVKLPEERVKVVEERTAFDTDPKSFRAGYKAKQDEIIDQVT
RARALLPEVEVPMEIRLKISQVCAELDVDGLRGDLVTTRASRAAAAFRGSKVVTDEDVYS
VVSLCLRHRLRKDPMATIDEGSRVIDVFSSVFGYETD
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgctgtttcatacagtcatcaacacgtaaacgcgctctgtagatggagccgg
ggatataagaacattcaaggcacgcgtggctgccgcgtgcagcagacacttcgccctaaa
gccgtttccaacgattccgaggtggaggatagtaccgctagacctgtatatcccttctgc
gctatcattggccaagaagagatgaagttcgcagcgctgatgaacatcatcgatccgaat
atcggcggcatcatggtgatgggcgatcgtgggactgggaagtcgacgacagtccgttcg
ttgactgatttacttccatacatcgaaatcgtgaaagatgatccgtttatgagtagccct
acggatccgaacttgatgtctcccgacgttttatcggcatatcgggccaagcaaccgctc
gagacttccttcgttcctatcaatatggttgacttacccttgggtgcaactgaggatcgc
gtatgcgggacgatcgatatcgagaaagcgttaactgaggggacgaaagccttcgaacct
ggtctcctcgccaaggcgaatcgcggaatactgtatgttgatgaagtcaacttactagac
gaccaccttgttgatgttttgcttgattcggcagcgtcgggctggaatacagtggagcgc
gagggaatcagtatatgtcacccggctcgtttcatcctcattggttccggtaacccagaa
gaaggcgaactgcgaccccagcttttagatcgcttcggcatgcatgcacaaatcaagact
gtgaaactgccagaagagcgggtcaaggttgtcgaagagcggactgcatttgacacggat
ccgaagtcgttccgcgcgggatacaaggcaaagcaggacgaaatcatagaccaggtgact
cgggcgcgcgccttgttaccggaggttgaggttcccatggaaatccgactgaaaatttcc
caagtctgcgctgagcttgacgtcgatggcctccgtggtgatctcgtgacgactcgcgca
tcacgtgcagctgcagccttccgaggttccaaggtagtgaccgacgaagacgtttattcg
gtagtgtcgctctgcctgcgtcacaggctccgtaaggatccaatggcgactattgatgaa
ggctctcgagttattgatgtcttttcatctgtgttcggttacgaaacggactga

DBGET integrated database retrieval system