KEGG   Ostreococcus lucimarinus: OSTLU_119573Help
Entry
OSTLU_119573      CDS       T01029                                 

Gene name
acnB
Definition
(RefSeq) aconitate hydratase
Organism
olu  Ostreococcus lucimarinus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_2_N Aconitase_B_N Aconitase Ketoacyl-synt_C
Motif
Other DBs
NCBI-GeneID: 5000445
NCBI-ProteinID: XP_001416185
JGI: 119573
UniProt: A4RSV0
Position
2:590250..593006
Genome map
AA seq 918 aa AA seqDB search
MNVRAAHRTLQSLVRVRSFGLLGCRLARCTSDLADSSTTLLPLLRTRSTGVIPVINVQSS
RSACVGTRGILDEYEQHKNDRAQLGIPAKPLSAKQVSELIALLEAPISEEEDRIYDMLVN
CISPGVDEAAYVKAGWLASVSKGKTVSPLVSREDAVRILGTMQGGYNISPLIDALDYDDL
GRIAAAALSDTLLIFDAFYDVQEKADKANKYAMQVVQSWADAEWFTKKSPPPSKITVTVF
KVPGETNTDDLSPAQDAWSRPDIPLHALAMLKSPREGIQNPISQIDELKKLGYPLAYVGD
VVGTGSSRKSATNSVLWHMGIDIPNVPNKRTGGVCIGGKIAPIFFNTMEDSGAFPIEMDV
KNIHMGDVIDIFPYEGLVKKHGTNEVITTFSLKSPVLLDEIQAGGRIPLIIGRSLTDKAR
NALGLEPSEVFQVPQVSKSRSKGFTLAQKMVGKACGVAGILPGTYCEPRVTTVGSQDTTG
PMTRDELKDLACLGFTADLVMQSFCHTAAYPKPVDVDTHHTLPTFIRNRGGVSLRPGDGV
IHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFGAATGVIPLDMPESVLVRFTG
HLQPGITLRDLVHAIPLQAIEDGLLTVAKEDKVNAFSGRILEIEGLEHLKCEQAFELSDA
SAERSAAGCTIKLDEASVKEYLTSNVALLKWMIANDYGEVRTLERRILAMQQWLAAPELL
RADDDAEYAATIEIDLNAITEPILCAPNDPDDARTLSSVVGDKVDEVFIGSCMTNIGHFR
AAAKLLNDNLSQLPTRLWVAPPTKMDELQLKVEGHYSTFATVGARTEMPGCSLCMGNQAR
VAEKSTVVSTSTRNFPNRLGKGANVYLASAELSAVCAILGRIPSKEEYLSHVEVLTNSTD
TYQYLNFDKLSYYTDVRE
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtacgagcagcgcaccgtacgcttcaatcacttgtgagagtgcgaagtttcggg
ctactcggctgccggctcgcacggtgtacgtcagacttagcggacagctcaacaactctg
ttgccgttgttgcgtacacgaagtacaggcgtaataccggttatcaacgtgcagtcgagc
cgtagcgcatgcgtcggtacaagggggattctagatgagtatgaacagcataaaaacgac
agggcccaactcggtatacccgcaaaacctctctctgcgaagcaagtatcagaactgatt
gccttgctggaagcaccgatcagcgaagaagaagaccgcatatatgatatgctagtaaac
tgcatttcacctggtgtcgatgaagcggcatatgttaaggcaggttggcttgcaagtgta
agcaaaggcaagactgtgagcccgttagtatcgcgggaagatgccgtccgtatccttggc
accatgcagggtggatacaacatctcgcctcttattgatgcacttgattatgacgacttg
ggtcgcattgccgctgccgctctttctgacaccctgttgatattcgatgcattttacgat
gttcaagagaaagcagataaagcaaataagtatgccatgcaagtagtgcagagttgggcg
gacgcagaatggttcacaaagaagagcccaccaccatcaaaaatcactgtaacagtgttc
aaagtgccaggtgaaacaaataccgatgatctttcgcccgctcaagatgcatggagtcgc
cccgatattcctctgcacgcccttgcgatgctcaaatcaccgcgtgaaggaattcaaaac
ccgatttctcaaatcgacgaactcaaaaaacttggatatccactggcgtatgttggcgac
gtcgttgggactggttcgtcacgtaagtctgcaacgaattctgtcttgtggcacatgggt
attgacattccgaacgttcccaataaacgcactggaggagtatgcatcggtggtaaaatt
gctccaattttcttcaacacaatggaggacagtggggcattccctatcgagatggacgtg
aagaatatacacatgggtgatgtcatagatatattcccgtatgagggtttagtcaagaaa
catggcacaaatgaggttatcacaactttttccctgaagagtcctgtgctattggatgaa
attcaggctggtgggcgcatcccactcattattggtcgatcgttgactgataaagctaga
aatgcattgggtctagagccttctgaagtatttcaagtgccccaggtctctaaatcacgt
tctaaggggtttacactcgcacagaagatggtggggaaggcatgtggtgtggctgggata
cttcccggcacatactgcgaacctcgtgtaacgactgtggggagtcaagatacgactggt
cctatgacacgtgacgagttgaaggatctggcttgtcttggtttcaccgccgatttagtc
atgcagtctttttgccatacggctgcatatcccaagcctgttgatgttgacactcaccac
actctccccacttttattcgcaaccgtggcggtgtatcgcttagaccaggagatggggtc
atacacagctggctgaatcgtatgctcttacctgatacagtaggtacaggtggcgactcg
cacactcgattcccgattgggatttcgtttccagctggctctggtttagtagcattcggt
gctgccactggagttattcctctcgacatgccagaatcagtacttgttcgtttcactggg
catctacagccaggtattactttgcgggatcttgtccacgctattccactgcaggcaatt
gaagatggattacttacagtcgcaaaagaagacaaagtcaacgcctttagtgggcgtatt
ttggaaattgaaggtcttgagcatctgaagtgtgaacaagcatttgaactgtcagacgct
agtgctgaaagaagtgcggctggctgtacaattaagctcgacgaagcaagcgtaaaggag
tatcttactagtaacgttgctcttcttaagtggatgatagccaatgattatggtgaggtt
cgtactctcgagcgcagaatcctcgcgatgcaacaatggctcgctgccccagagctttta
cgggctgatgatgatgctgagtacgctgcgacgatcgaaattgatttgaacgcaatcaca
gaacctatattatgtgcaccgaatgatccagatgacgcacgtacactttcttctgtagtt
ggtgataaagttgacgaggtgttcataggctcttgcatgacgaacattggtcatttcaga
gctgcggcaaagcttttgaacgacaatctcagtcagcttcccactcgactttgggtggca
cccccaacaaagatggacgaattgcagctgaaagttgaaggacattacagcacttttgct
acggtaggcgcgaggacagagatgccagggtgctctttgtgtatgggaaaccaagcgaga
gttgctgaaaagagcacagtagtttctacaagtactcggaactttcccaatcgtcttggt
aaaggtgcaaatgtttatctagcatctgcagaactttctgctgtttgcgcgattctaggc
cgaataccatcaaaggaagaatacttgagccatgttgaagtgcttacgaacagtactgac
acgtaccagtacctcaacttcgacaaattgagctattacacagatgtacgcgagtaa

DBGET integrated database retrieval system