KEGG   Ostreococcus lucimarinus: OSTLU_12211Help
Entry
OSTLU_12211       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     OSTLU_12211
Protein kinases [BR:olu01001]
 Serine/threonine kinases: AGC group
  PKG family
   OSTLU_12211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase cNMP_binding Pkinase_Tyr Kinase-like Cupin_3 Cupin_2
Motif
Other DBs
NCBI-GeneID: 5000137
NCBI-ProteinID: XP_001416116
JGI: 12211
UniProt: A4RT89
Position
2:join(273051..273203,273339..273806,274644..275609)
Genome map
AA seq 528 aa AA seqDB search
MDGNLLFVELDARARRRVMDAMTPSYVDEGEIVIAQGDTNCDRFYVIEIGETAKQVATLG
PGRGFGELALLYACPRSATVVAATPLKLWTLHASAFKAIKRSIATKDASCMLELLESVEL
FNALSEQQLIAICTAARREVYETNDVVFNQGDPGNCFYIVERGEVSVRVHGGEVAKLSRG
DFFGERALINNEPRAATIVAATDISCLKPVTAELEELQTIGFLGVGSFGRVTLVAHDGET
YALKEIGKAQVVARGLVEHVWREKQTMAQCDSPFLVNLRRTYVSERSIYMLMDKVLGGEL
FTYLQTRNSPLPEAHAKFYAACVVLAFEYLHDRQITYRDLKPENLLICTNGYLKVTDFSF
AKKLPKGAKTFTLCGTPQYLAPEQVQQVGHNRAVDWWAVGVLVYELVNGVPPFNQDDHYQ
MYKAINEVKFHFSPRNGPKFRAVVSGLLRRMPASRLGMGKTGAREIKQHEWFADINWSAL
AQQRARAPYVPLVEDVRDLRHFVDTGDDVPGLSAKWGTYASIGRFTDF
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggatgggaatttgctcttcgtcgagctggacgcgcgagcgcgacgacgggtgatggac
gccatgacgccctcgtacgtcgacgagggcgagatcgtgatcgcgcagggcgatacgaat
tgcgatcgattctacgtgatcgaaatcggggagaccgccaagcaagtggcaacgcttggc
ccgggtcggggattcggcgagctcgcgctgctgtacgcctgcccgcgatcggcgacggtc
gtggcggcgacgccgttgaaactgtggacgctgcacgcgagcgcgttcaaggcgataaag
cgttccatcgcgacgaaggatgcatcttgtatgctcgaacttctggagagcgtggagcta
ttcaacgctctgtcagagcaacagctgattgcgatatgtaccgcggcgagaagagaggtg
tacgagacgaatgacgttgtattcaatcaaggcgatcccggaaattgcttctacatcgtg
gaacgcggcgaggtgagcgttcgagtccatggtggcgaagtcgcgaaactctcgcgtggc
gatttcttcggtgagcgcgcactgataaataatgaacctcgtgcggcgacgatcgtcgcc
gcaaccgacatttcgtgtttgaaaccggtgacagctgagctcgaggagctccaaaccatc
ggtttcttaggcgttggatcgttcggtcgagtgacgcttgtggctcacgatggagagacg
tacgcgctgaaggaaattggcaaagcacaagttgtcgctcgcgggttggtcgagcacgtg
tggcgcgaaaagcaaaccatggcgcaatgtgactcaccgttcttggtaaaccttcggcgt
acctacgtcagcgaaagatcgatttacatgctcatggacaaagttcttggtggagagctt
tttacgtacttgcaaactcgaaactcgccgctgcccgaggcgcacgccaaattttatgcg
gcgtgcgtggtgctggcattcgagtatctgcacgaccggcagatcacttaccgcgattta
aagccagagaaccttctgatttgtacaaatggttatctcaaagtcacggacttttcgttc
gcgaagaaacttccgaagggcgcgaaaacttttacgctgtgcggcacgccacaatacttg
gcgcccgagcaagtacaacaagtcggccacaatcgcgccgtcgattggtgggcggttggc
gttttggtgtacgaactcgtcaacggcgtcccacctttcaatcaagacgaccactaccaa
atgtacaaggcgatcaacgaggtcaaattccacttttcgcctcgcaacggccccaaattc
cgcgccgtcgtctccggcctccttcgccgcatgcccgcgagtcgactcggcatgggcaaa
accggcgcacgcgaaatcaagcagcacgagtggtttgcagacataaactggagcgctctc
gcgcagcaacgcgcgcgcgcgccgtacgtgccgctcgtcgaagacgttcgcgatttaagg
cactttgtggacaccggcgacgacgtcccgggactctccgcgaagtggggcacctacgcc
tccatcgggcgatttaccgacttttaa

DBGET integrated database retrieval system