KEGG   Ostreococcus lucimarinus: OSTLU_15043Help
Entry
OSTLU_15043       CDS       T01029                                 

Gene name
CYC1
Definition
(RefSeq) predicted protein
  KO
K08738  cytochrome c
Organism
olu  Ostreococcus lucimarinus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 5001301
NCBI-ProteinID: XP_001417250
JGI: 15043
UniProt: A4RW27
Position
4:join(459603..459645,459807..459874,460047..460274)
Genome map
AA seq 112 aa AA seqDB search
MSTFSEAPAGNAAKGAKIFKTKCAQCHVAEKGGGHKQGPNLGGLFGRVSGTTEGFSYSAA
NKNKGVTWSENTLYDYLLNPKKYIPGTKMVFAGLKKPEDRADLIAYLKESTK
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgttcagcgaagcgccggcggggaacgccgcgaagggagcgaagatttttaag
acgaagtgcgcgcagtgccacgtcgcggagaagggcggtggacacaagcagggtcctaac
ctcggcggcttgttcggccgcgtctccggcaccacggagggtttctcgtacagcgcggcg
aacaagaacaagggcgtcacatggagcgagaacaccctgtacgactacctgttgaacccg
aagaagtacattccgggcacgaagatggtcttcgccggtctgaagaagccggaagaccgc
gcggatttgatcgcgtacctgaaggagagcaccaagtag

DBGET integrated database retrieval system