KEGG   Ostreococcus lucimarinus: OSTLU_17180Help
Entry
OSTLU_17180       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K06195  ApaG protein
Organism
olu  Ostreococcus lucimarinus
Brite
KEGG Orthology (KO) [BR:olu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    OSTLU_17180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 UVR
Motif
Other DBs
NCBI-GeneID: 5003940
NCBI-ProteinID: XP_001420215
JGI: 17180
UniProt: A4S462
Position
10:complement(565981..566646)
Genome map
AA seq 221 aa AA seqDB search
MRLDERLADAIACENFAAAANVRDELRALRRRDPLARAEDDLAELILREDYEKAASVKML
IEELERDAVVDGLSPCESDRTTRGVRVRVKSRCVIDRSSPKESMWFFQYVVTITNVSDSS
VKLLSRSWLITDDEGRTEAVRGAGVVGKQPTIKPGASFEYASSTPLKTKRGTMEGFYRFV
AVDAEEASRAESVTMDLAREDDPSAFNVEIGVFGLSESATS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcggctggacgagaggttggcggacgcgatcgcgtgtgagaattttgcggcggcggcg
aacgtgcgggacgagctgcgcgcgctgcgacgacgcgatccgctggcgcgggcggaggac
gacttggcggagctgattttgcgcgaagactacgaaaaggcggcgagcgtgaagatgttg
atcgaggaactcgagcgagacgccgtcgtggacgggctgtcgccgtgcgagagcgatcgc
acgacgcgcggcgtgcgcgtgcgggtgaaatcgcgatgcgtgatcgatcgaagctcgcca
aaggaatctatgtggtttttccagtacgtcgtgacgattacaaacgtctccgactccagc
gtcaagttgttgagtcgaagctggttgatcacggacgacgagggacgaacggaagccgtg
cgcggagccggggtcgtgggcaagcaaccgacgatcaaaccgggcgcgagcttcgagtac
gcgtcgtcgacgcctttgaagaccaagcgcggtacgatggaaggcttttacagattcgtc
gccgtcgacgccgaggaggcgtcgcgcgcggaatccgtgacgatggacctcgcgcgcgag
gacgatcccagcgccttcaacgtcgagatcggcgttttcggcttgtccgaatccgcgacg
tcttga

DBGET integrated database retrieval system