KEGG   Ostreococcus lucimarinus: OSTLU_27414Help
Entry
OSTLU_27414       CDS       T01029                                 

Gene name
ADHX
Definition
(RefSeq) Zn-containing alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00010  Glycolysis / Gluconeogenesis
olu00071  Fatty acid degradation
olu00350  Tyrosine metabolism
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
olu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:olu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OSTLU_27414 (ADHX)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OSTLU_27414 (ADHX)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    OSTLU_27414 (ADHX)
Enzymes [BR:olu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     OSTLU_27414 (ADHX)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     OSTLU_27414 (ADHX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 TrkA_N 2-Hacid_dh_C AlaDh_PNT_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 5005507
NCBI-ProteinID: XP_001421423
JGI: 27414
UniProt: A4S7A9
Position
14:complement(join(224455..225459,225557..225715))
Genome map
AA seq 387 aa AA seqDB search
MSRAGEPIACKAAVAFAPREPLRIVDVVVAPPQAGEVRIKIAYNALCHTDAYTLGGHDSE
GKFPCILGHEAAGTVESVGEGVTSCKAGDRVIPCYQAYCADIAKEPCAHCVHPKSNLCQA
VRAYTGAGVMKNDGKPRFTLASDGSEIFHFMGTSTFSEYTVVHEVAVAQVGNDEAPLDKV
CLLGCGVSTGWGAVHNTARVEEGSSVAVFGLGAVGLACVEAAVEAGATRIIAVDTNDEKE
AVAREFGATDFVNPTKFGDKNSQTVIAEMTDGGVDYSFECVGNVNVMRSALECCRKGWGT
SVIVGVAAAGTEISTRPFQLVTGRTWKGTAFGGYKSRIAVPKLVEKYMGGNTKLDRYITH
RMKFDQINEAFELLHEGKCLRCVLSFD
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcgcgggcgagccgatcgcgtgcaaggcggcggtggcgttcgcgccgcgcgag
ccgctgcgaatcgtcgacgtcgtcgtcgcgccgccgcaggcgggcgaagtgcgaattaaa
atcgcgtacaacgcgctgtgtcacacggatgcgtacacgctcggcggacacgactcggag
gggaagtttccgtgcatcctgggacacgaggcggcggggacggtggaatccgtcggcgag
ggcgtgacgtcgtgtaaagcgggcgatcgggtgattccgtgctatcaggcgtactgcgcg
gacatcgcgaaggagccgtgcgcgcactgcgtgcatccgaaatcgaacctgtgtcaggcg
gtgcgggcgtacacgggcgcgggggtgatgaagaacgacgggaagccgagatttacgctc
gcgagcgacgggtcggagatttttcacttcatgggaacgtcgacgttttccgagtacacg
gtggtgcacgaggtggcggtggcgcaggtggggaacgacgaggcgccgttggataaggtg
tgcctgctgggatgcggcgtgagcacggggtggggggcggtgcataacacggcgcgggtc
gaagaggggagctccgtggcggtgtttggtctgggcgccgtcggattggcgtgcgtggag
gcggctgtggaggcgggcgcgacgcgcatcatcgctgtcgacaccaacgacgaaaaggaa
gccgtggcgcgcgagttcggcgccacggattttgtgaacccgacaaagtttggcgataaa
aattcacaaactgtcatcgcggagatgacggacggtggagtggattattcgttcgaatgc
gtcggaaacgtcaacgtcatgcgaagcgctttggaatgctgccgcaaggggtgggggact
tccgtcatcgtcggcgtcgccgccgcgggcacggaaatctcaaccagaccattccaactc
gtcaccggtcgcacgtggaaaggtaccgctttcggcgggtacaagagccgcatcgccgtg
ccgaaactggtcgaaaagtacatgggcggaaacacgaaactcgacagatacatcacgcac
cgcatgaagtttgatcaaatcaacgaagcgttcgagctgttgcacgaaggcaagtgctta
cgatgcgtgttgagcttcgattaa

DBGET integrated database retrieval system