KEGG   Ostreococcus lucimarinus: OSTLU_28400Help
Entry
OSTLU_28400       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00630  Glyoxylate and dicarboxylate metabolism
olu00710  Carbon fixation in photosynthetic organisms
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
olu01200  Carbon metabolism
Module
olu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
olu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:olu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OSTLU_28400
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OSTLU_28400
Enzymes [BR:olu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     OSTLU_28400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 5006329
NCBI-ProteinID: XP_001422165
JGI: 28400
UniProt: A4SA22
Position
17:join(339915..340024,340407..340806)
Genome map
AA seq 169 aa AA seqDB search
MSAITQASAQVAKTVAVTTGKVANAKSMMIWRPHGNKMFETFSFLPPLSDAEISKQVQYL
LNNGWTPCIEFEDSAHAYTDGHGWANMDTSINAGYYDNRYWVMWKLPMYGCQNPDEVIAE
INTCIKCFPDCYVRVAGFDNIKQVQCSAFLAHRPASEAACAVDQRQVQG
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccatcacccaagcctccgcgcaagtcgcgaagaccgtcgccgtcaccaccggc
aaggtcgccaacgccaagtccatgatgatctggcgcccgcacggcaacaagatgttcgag
accttctccttcttgccgccgctctccgacgctgaaatctccaagcaagtgcaatacttg
ttgaacaacggctggaccccgtgcatcgagttcgaagactccgcgcacgcgtacaccgac
ggccacggctgggcgaacatggacacctccatcaacgccggttactacgacaaccgttac
tgggttatgtggaagctccccatgtacggctgccaaaacccggatgaagtcattgcggaa
atcaacacctgcatcaagtgcttcccggattgctacgtccgcgtcgctggcttcgacaac
atcaagcaagtgcaatgctccgcgttcttggctcaccgcccggcgtccgaagctgcgtgc
gccgttgaccagcgccaagtccaagggtaa

KEGG   Ostreococcus lucimarinus: OSTLU_42060Help
Entry
OSTLU_42060       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00630  Glyoxylate and dicarboxylate metabolism
olu00710  Carbon fixation in photosynthetic organisms
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
olu01200  Carbon metabolism
Module
olu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
olu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:olu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OSTLU_42060
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OSTLU_42060
Enzymes [BR:olu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     OSTLU_42060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 5006223
NCBI-ProteinID: XP_001422271
JGI: 42060
UniProt: A4SA21
Position
17:complement(338789..>339193)
Genome map
AA seq 134 aa AA seqDB search
RRMFETFSFLPPLSDAEISKQVQYLLNNGWTPCIEFEDSAHAYTDGHGWANMDTSINAGY
YDNRYWVMWKLPMYGCQNPDEVIAEINTCIKCFPECYVRVAGFDNIKQVQCSAFLAHRPA
SEAACAVDQRQVQG
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
cgcaggatgttcgagaccttctccttcttgccgccgctctccgacgccgaaatctccaag
caagtgcaatacttgttgaacaacggctggaccccgtgcatcgagttcgaagactccgcg
cacgcgtacaccgacggccacggctgggcgaacatggacacctccatcaacgccggttac
tacgacaaccgttactgggttatgtggaagctccccatgtacggctgccaaaacccggat
gaagtcattgcggaaatcaacacctgcatcaagtgcttcccggaatgctacgtccgcgtc
gctggcttcgacaacatcaagcaagtgcaatgctccgcgttcttggctcaccgcccggcg
tccgaagctgcgtgcgccgttgaccagcgccaagtccaagggtaa

KEGG   Ostreococcus lucimarinus: OSTLU_89572Help
Entry
OSTLU_89572       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00630  Glyoxylate and dicarboxylate metabolism
olu00710  Carbon fixation in photosynthetic organisms
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
olu01200  Carbon metabolism
Module
olu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
olu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:olu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OSTLU_89572
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OSTLU_89572
Enzymes [BR:olu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     OSTLU_89572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 5006224
NCBI-ProteinID: XP_001422166
JGI: 89572
UniProt: A4SA23
Position
17:342004..342537
Genome map
AA seq 177 aa AA seqDB search
MLGAGGCFVLGSDAVHERRHGWASVEDSRERCTDRFRFVFTSSRRMFETFSFLPPLSDAE
ISKQVQYLLNNGWTPCIEFEDSAHAYTDGHGWANMDTSINAGYYDNRYWVMWKLPMYGCQ
NPDEVIAEINTCIKCFPDCYVRVAGFDNIKQVQCSAFLAHRPASEAACAVDQRQVQG
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgctcggcgcgggagggtgtttcgtactcgggtcggacgcggtccacgagcgacgtcac
ggttgggcgagcgtagaagactcgcgcgagcgctgtactgaccgatttcgcttcgttttt
acgtcgtcacgcaggatgttcgagaccttctccttcttgccgccgctctccgacgccgaa
atctccaagcaagtgcaatacttgttgaacaacggctggaccccgtgcatcgagttcgaa
gactccgcgcacgcgtacaccgacggccacggctgggcgaacatggacacctccatcaac
gccggttactacgacaaccgttactgggttatgtggaagctccccatgtacggctgccaa
aacccggatgaagtcattgcggaaatcaacacctgcatcaagtgcttcccggattgctac
gtccgcgtcgctggcttcgacaacatcaagcaagtgcaatgctccgcgttcttggctcac
cgcccggcgtccgaagctgcgtgcgccgttgaccagcgccaagtccaagggtaa

DBGET integrated database retrieval system