KEGG   Ostreococcus lucimarinus: OSTLU_28757Help
Entry
OSTLU_28757       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K05298  glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) [EC:1.2.1.13]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00710  Carbon fixation in photosynthetic organisms
olu01100  Metabolic pathways
olu01200  Carbon metabolism
Module
olu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
olu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:olu00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OSTLU_28757
Enzymes [BR:olu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.13  glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating)
     OSTLU_28757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N
Motif
Other DBs
NCBI-GeneID: 4999391
NCBI-ProteinID: XP_001415434
JGI: 28757
UniProt: A4RQR7
Position
1:join(256470..256487,256737..256811,256913..256976,257291..258354)
Genome map
AA seq 406 aa AA seqDB search
MSAAVKTVELTARTALAGNFRKATAPRAAAKANVNVVTEAKVKVAINGFGRIGRNFVRCW
KSRGPDCPLQVVCVNQSGGAKPAAHLLKYDSILGTFKSDVKVVDDATISVDGDIIKVVSD
RDPLNLPWKEMGIDIVIEGTGVFLDGPGAGKHIQAGAKKVVITAPAKGSDIPTYVVGVNA
DQYDNSANIVSNASCTTNCLAPFAKVIDDKFGIVKGTMTTTHSYTGDQRILDASHRDLRR
ARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGVTAEE
VNAAFKEAQDGPMKGVLAITDVPLVSVDFRCTDVSTTIDAALTMVMGDDMVKVVAWYDNE
WGYTQRVVDLSLIVANGLINEGVASADPMDQLCADDPSADECKVFD
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgccgttaagaccgtcgaactcaccgcccgcaccgcgctcgcgggtaacttc
cgcaaggcgaccgcgccgcgcgcggccgcgaaggccaacgtgaacgtggtgaccgaggcg
aaggttaaggttgccatcaacggtttcggccgcatcggccgcaacttcgtgcgatgctgg
aagagccgtggcccggactgcccgctccaagtcgtgtgcgtgaaccaatccggcggcgcc
aagccggcggcgcacttgctcaagtacgactccatcttgggtacgttcaagtctgacgtc
aaggttgtcgacgacgccacgatctccgtcgatggtgacatcatcaaggttgtgtccgat
cgcgacccgctcaacttgccgtggaaggaaatgggcatcgacatcgtcatcgaaggtacg
ggcgtcttcctcgacggcccgggcgcgggcaagcacatccaagccggcgccaagaaggtt
gttatcaccgccccggccaagggctccgacatcccgacctacgtcgtcggtgtgaacgcc
gaccaatacgacaactctgccaacattgtctccaacgcgtcgtgcaccaccaactgcttg
gcgccgttcgccaaggtgatcgacgacaagttcggcatcgtcaagggtacgatgaccacc
acgcactcttacactggtgatcaacgcatcttggatgcgtcccaccgtgacttgcgccgt
gctcgtgccgccgccttgaacatcgtgccgacctccaccggtgccgccaaggctgttgcg
ctcgtcttgccgcaactcaagggtaagctcaacggtatcgcgcttcgcgtgccgacgccg
aacgtgtccgtcgtcgacctcgtcgtcaacgttgagaagaagggcgtcaccgctgaagaa
gtcaacgccgcgttcaaggaagcgcaagatggcccgatgaagggtgttcttgcgatcacc
gatgtcccgctcgtgtctgtcgatttccggtgcaccgacgtgtccaccaccattgacgcg
gctctcaccatggtgatgggcgatgacatggtcaaggttgtcgcgtggtatgacaacgaa
tggggttacacccaacgcgtcgtcgacctctccctcatcgtcgccaacggcctcatcaac
gaaggtgttgcctccgccgacccgatggaccaactctgcgcggatgatccctcggcggac
gaatgcaaggtgttcgattaa

KEGG   Ostreococcus lucimarinus: OSTLU_37993Help
Entry
OSTLU_37993       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K05298  glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) [EC:1.2.1.13]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00710  Carbon fixation in photosynthetic organisms
olu01100  Metabolic pathways
olu01200  Carbon metabolism
Module
olu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
olu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:olu00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OSTLU_37993
Enzymes [BR:olu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.13  glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating)
     OSTLU_37993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N
Motif
Other DBs
NCBI-GeneID: 5003948
NCBI-ProteinID: XP_001420043
JGI: 37993
UniProt: A4S475
Position
10:586719..587744
Genome map
AA seq 341 aa AA seqDB search
MKGKQCKVAINGFGRIGRNFLRCWHGRANTMLDIVAINDSGGVKQASHLVKYDSVLGTFE
ADVKIIDDTHISIDGKSIEIVSSRDPLQLPWKALGVDIVIEGTGVFIDTPGASKHLTAGA
KKVVITAPAKGDDIPTYVLGVNADQYKNTDKIVSNASCTTNGLAPFVKVLDDRFGIVKGL
MTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRV
PTPNVSVVDLVIQTSKKVTADEVNAAFREEAAGKLKGILAVADEPLVSCDFKCSDVSTSI
DAALTMVMGDDMLKVVAWYDNEWGYSQRVVDLAELCAANWE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtaagcaatgcaaggttgccatcaacggtttcggccgcatcggccgcaacttc
ttgcgatgctggcacggacgcgccaacaccatgctcgacatcgtcgccatcaacgactcg
ggcggagtgaagcaagcgagccacttggtcaagtacgactccgtcctcggcacgttcgag
gcggatgtcaagatcatcgacgacacgcacatctccatcgacggcaagtccatcgagatt
gtgtcttcccgtgacccgctccagttgccgtggaaggctctcggcgtcgacatcgtcatt
gaaggtaccggcgtcttcatcgacaccccgggcgcctccaagcacttgaccgcgggcgcc
aagaaggttgtcatcacggccccggccaagggtgacgacatcccgacctacgtcctcggt
gtcaacgccgaccagtacaagaacaccgacaagatcgtctccaacgcgtcgtgcacgacc
aacggcctcgcgccgttcgtcaaggttctcgacgaccgattcggcatcgtcaagggtttg
atgaccaccacgcactcctacaccggtgaccagcgcattttggatgcgtctcaccgtgac
ttgcgccgcgctcgcgccgccgccttgaacatcgtgccgacctccaccggcgccgccaag
gctgtcgcgctcgtcttgccgcaactcaagggcaagctcaacggcatcgcgctccgcgtc
ccgacgccgaacgtgtccgtcgtcgatctcgtcatccaaacctccaagaaggtcaccgcc
gacgaagtcaacgccgcgttccgtgaagaagccgccggcaagctcaagggtatcctcgcc
gtcgccgacgagccgctcgtgtcttgcgatttcaagtgctccgacgtctccacgtccatc
gacgccgcgctcaccatggtcatgggtgacgacatgttgaaggttgtcgcgtggtatgac
aacgagtggggctattcgcaacgcgtagtggacttggcggaattatgcgcagcaaactgg
gaatga

DBGET integrated database retrieval system