KEGG   Ostreococcus lucimarinus: OSTLU_28903Help
Entry
OSTLU_28903       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:olu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    OSTLU_28903
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:olu03041]
    OSTLU_28903
Enzymes [BR:olu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     OSTLU_28903
Spliceosome [BR:olu03041]
 Complex C
  Other components
   Step II factors
    OSTLU_28903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_19 AAA_30 Flavi_DEAD DUF2075 SRP54 ABC_tran T2SSE Herpes_ori_bp AAA_29
Motif
Other DBs
NCBI-GeneID: 4999455
NCBI-ProteinID: XP_001415516
JGI: 28903
UniProt: A4RR62
Position
1:join(500604..500679,500794..502892)
Genome map
AA seq 724 aa AA seqDB search
MARAVGDDDDHPSTSSTDDLPVSRYANDIASAVKTNAVTVVIGETGSGKTTQIAQILLRS
GVVADGSAVAVTQPRRVAAVSVAKRVAEEMGVEIGKEVGYSVRFEDRTCRLTRIKYLTDG
TLLRELLEDPTLSRYSVVVLDEAHERSLHTDILFGLLKKLVSARELKLVITSATLDSEKF
STYFDDAPVFTVPGRTFPVQIAHATEAPKSYFQSAIETVVDVHVNTGPGDMLVFLTGQEE
IEKACRAVEAHVRSMPEGECPDVQVLPLYASLPPDMQSRVFHPHDPNVRRIIFATNIAET
SLTVPGIVFVIDPGVVKQVEYDAMTGMNALKVVPISSVQAKQRAGRAGRTQAGRCYRLYT
KDALELDMPAITRPEIQRTCLVGTILYLKTLNLKGLDVMTFDFLDPPDTALIADALRQLY
FVGAIDPDGKATSIGREMSSLPLEPCLSRAMVEAKRLDCVADTATVAAMLSVERVFLGQH
RDATESLHELATHEDFLLGDHAVLLRIYQAWESSGYQRKFHQRYSLSDRGMEFAREIRKQ
LLGVFKDKRKSDRNDFDCFSRTDEGLNRLRQSLCAGFVTKIAHRLPNHNGYRTLGENSTL
CQVHPSMARQLADKDGLLPEWIVYHELITTSRPFLRHVCKIEPEWISKQRELLSKKVNIH
RLSGGVLSPGDAESTDAASGHEADTVDANKAPVEGRRITDEQVSAARERFLARKKQKLAK
LAGK
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgcggttggtgacgacgatgatcatccttcgacgtcttccacggacgactta
ccggtctcgcgttacgcgaacgatattgcgagtgcggtaaagacgaatgcggtgacggtt
gtgattggggagacggggagcgggaagacgacacagattgcgcagattctcctgcgctca
ggcgtcgtcgccgacggctcggcggtggcggtgacgcagccgagacgtgtggcagctgtt
tccgtggcaaaacgcgtcgcagaagaaatgggggtagagattgggaaagaagttgggtat
tcggtgcgctttgaggacagaacgtgccgcctgacgaggataaaatatttaactgacggc
acgttactgcgagagcttctcgaagacccgactctgtcgcgttacagtgtcgtcgtcttg
gatgaggctcatgagcggtcgttgcacacagatatattattcggattattgaagaagctc
gtgtccgcgcgtgaactgaagctggtgattacttcggccacgctcgacagcgaaaaattc
tcgacgtatttcgacgacgcaccggtgttcaccgtgcctggacgcacgtttccggttcaa
atcgcgcacgccaccgaggctccaaagtcgtactttcaaagtgcgattgaaacggtggtg
gatgtacatgtgaataccggccctggggatatgttggtgttcctaacaggtcaagaagag
attgaaaaagcgtgtcgggctgtggaggctcacgtgcgatcgatgcccgagggagagtgt
ccagatgtgcaagtcttgccactctatgcatcactcccaccggatatgcagtcgagggtg
tttcacccacatgatccgaacgtgcgacgaataatctttgcgacaaatattgctgagacg
tcgctgacggtcccaggaatcgtttttgtgattgatccaggcgtggtgaagcaggttgag
tacgatgcgatgacgggaatgaatgcattaaaagtagtgcctatcagtagcgtgcaggcg
aagcagcgtgcaggacgtgcaggaagaacgcaagctgggcgatgctaccgactgtacaca
aaggacgcgctcgaactcgacatgccagcgatcactcggccagagatccaacggacatgt
ctagtcggtacgattctgtatctgaagacactgaatctaaaaggactagatgtgatgact
ttcgatttcttggatcctccagacactgcactcatcgcagatgctttgcgccaactttat
ttcgttggtgcaatcgatcccgatgggaaggcaacttctattggacgagagatgagttcg
cttccacttgagccatgcttatcgcgtgcgatggtcgaagcgaaacgccttgattgtgtt
gcagatactgcaacagttgccgcgatgttgagcgtcgaaagagtgtttttaggtcagcac
cgagatgcaactgagagtcttcacgagcttgcgactcacgaagattttcttcttggcgat
cacgcggtgttacttcgaatctatcaagcctgggagagcagtggatatcaaagaaaattt
caccagcggtattcgttgtcggatcgaggaatggagttcgcgcgagagatacgaaaacaa
ttacttggagtgttcaaggacaagcgtaaaagcgataggaacgactttgattgtttctca
cgaacagatgaaggtctgaaccgattgcgccaatcgctgtgcgcaggcttcgtgacaaag
attgcgcatcgactaccgaatcataatggctacagaacattgggagaaaattccacgctg
tgccaggtccacccttctatggctcgccaactcgccgacaaagacggtttgcttccagag
tggatcgtttaccatgagttgatcacgacttctcgaccctttctccgccacgtgtgcaaa
attgagccagaatggatttcaaagcaaagagagctgctctcgaagaaggtgaacattcat
cgtctctctggcggcgtgttgagccccggggatgctgaaagcacggacgcagcgagtggg
cacgaagccgacacggtggacgcgaataaagcgccagtcgaaggacgtagaatcaccgac
gagcaagtttctgccgcgcgagagcgcttcctggcgcgtaagaaacagaaattagcgaaa
ttagcgggaaaatag

DBGET integrated database retrieval system