KEGG   Ostreococcus lucimarinus: OSTLU_30288Help
Entry
OSTLU_30288       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00010  Glycolysis / Gluconeogenesis
olu00710  Carbon fixation in photosynthetic organisms
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
olu01200  Carbon metabolism
olu01230  Biosynthesis of amino acids
Module
olu_M00002  Glycolysis, core module involving three-carbon compounds
olu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
olu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:olu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OSTLU_30288
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OSTLU_30288
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:olu04147]
    OSTLU_30288
Enzymes [BR:olu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     OSTLU_30288
Exosome [BR:olu04147]
 Exosomal proteins
  Proteins found in most exosomes
   OSTLU_30288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK
Motif
Other DBs
NCBI-GeneID: 5000494
NCBI-ProteinID: XP_001416265
JGI: 30288
UniProt: A4RSD5
Position
2:831571..832965
Genome map
AA seq 464 aa AA seqDB search
MPRVRALADARDLTNKIVLVRVDHNCVKRGVVRDVHRIEQSLPTLYNIVERGGRPILMTH
VNRPRSAKTGEIARDDDEDGVAAIVDVLRMKLGVTFAAPSFRSDGARGIRSVDTSVNFLL
DDLRARRIGGIYLPNTRWFEGEEAGEGTEAYEALARQLAGLADVYVNDAFGSWQAHASTV
GITKYLPSYAGLLMQKELRAVEAVLNPKRPFVAVVAGAKVDTKLGTLKAVAARCDSLILG
GVVYNAYLCAKYDIEVEGVSEGDVELARELLSPEAQAKIIELPVVVESTSLKGCGCIPKE
GECGDPKETLGATRALRVSDLQRGASYGYFLDVAASSFEDEKVKNALHGAKCIFVNAVMG
FTSSGFHEGTTALDHAIAANKGARKYFGGGDTIQEFKSLTPALYLSAAVDPTFYLFTGGG
TVLRALELGGAEKLETVQCLMADDDEEIEPHAEPKCMRFADCAC
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcgtgcgcgcgctcgcggacgcgcgcgatctgacgaataaaatcgttctcgtc
cgcgtcgatcacaactgcgtgaagcgcggcgtcgtgcgcgacgtgcacaggatcgaacag
tcgctgccgacgctgtacaacatcgtcgagcgcggcggacgaccgatcctgatgacgcac
gtcaatcgaccgcgaagcgcgaagacgggggagatcgcgcgcgatgacgacgaggacggc
gtggcggcgatcgtggacgtgctgcggatgaaactgggggtgacgttcgcggcgccgagc
tttcgaagcgacggcgcgcgagggatacgaagcgtggacacgagcgtgaacttcttgctg
gacgatctgcgagcgcggaggatcggagggatatacctgccgaacacgcggtggttcgag
ggcgaagaggcgggagaggggacggaggcgtacgaggcgctggcgagacagctggcgggg
ttggcggacgtgtacgtgaacgacgcgttcgggtcgtggcaggcgcacgcgtcgacggtt
gggatcacgaaatacttgccgagttacgccgggttgttgatgcagaaggagctgcgcgcg
gtggaggcggtgctgaatccgaagcgaccgttcgtcgccgtcgtggcgggggccaaggtg
gacacgaagctcggaacgctcaaggcggtggcggcgcggtgcgattcgttgattctcggt
ggagtggtttataacgcgtatttatgcgcaaagtatgacatcgaggtcgaaggcgtgagc
gagggggacgtggagctggcgagggagcttctgtcgcccgaggcgcaggcgaaaatcatc
gagctcccggtggttgtggaatccacgtcgctcaaagggtgcggttgcatccctaaagag
ggcgagtgcggagacccgaaagaaacgctaggggccacgcgcgcgcttcgagtgagcgat
ctccagcgcggggctagttacggatactttctcgacgtcgccgcgagttcgtttgaagac
gaaaaggtgaaaaacgctctgcacggagcaaagtgtatcttcgtcaacgccgtcatgggg
ttcacatccagtggatttcacgaaggcacgaccgcgctggatcacgccatcgcggcgaat
aagggcgcgcgtaaatattttggcggcggcgacacgattcaagagttcaagtcgctcacg
cccgcgctgtacttatctgccgccgtagacccgacgttttacttattcaccggtggtggt
accgtgctcagagcgttagagttgggtggcgccgaaaaattggaaactgtgcagtgtctc
atggcggatgacgacgaggagattgagccgcacgccgaaccaaagtgcatgcgattcgcc
gattgcgcgtgttag

KEGG   Ostreococcus lucimarinus: OSTLU_46028Help
Entry
OSTLU_46028       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00010  Glycolysis / Gluconeogenesis
olu00710  Carbon fixation in photosynthetic organisms
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
olu01200  Carbon metabolism
olu01230  Biosynthesis of amino acids
Module
olu_M00002  Glycolysis, core module involving three-carbon compounds
olu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
olu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:olu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OSTLU_46028
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OSTLU_46028
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:olu04147]
    OSTLU_46028
Enzymes [BR:olu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     OSTLU_46028
Exosome [BR:olu04147]
 Exosomal proteins
  Proteins found in most exosomes
   OSTLU_46028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK
Motif
Other DBs
NCBI-GeneID: 5002433
NCBI-ProteinID: XP_001418373
JGI: 46028
UniProt: A4RYF0
Position
6:complement(join(106456..106457,106567..107569,107706..108008))
Genome map
AA seq 435 aa AA seqDB search
MQSLATFTGFKPAAAPRQRLSAPRARPAATRAAVVVEAKKKSVGDLAESDLKGQTVFVRC
DLNVPMDADLNITDDTRIRAAIPTLEYLAKNGAKVLVTSHLGRPKNGPEDKFRLTPVGAR
LSEKLSCPVTKVDDCVGDEVAKAVASMPNGSVCLLENTRFYKEEEKNDSDFAKKLAGSAT
IFVNDAFGTAHRAHASTEGVTKYCKTNVAGFLLQKELDYLDGAVSNPERPFCAIVGGSKV
SSKIGVIESLLQKTDKIILGGGMIFTFYKALGKSVGASLVEDDKIDLAKELMAKAEAKGV
KILLPTDVVVADKFAEDAKTQIVSVDNIPEGWMGLDIGPDSLKAFQGELNECKSVIWNGP
MGVFEMDAFAKGTFGIADTLANLNGITIIGGGDSVAAVEKAGLADKMSHISTGGGASLEL
LEGKVLPGVAALDEA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcgctcgccacgttcaccggcttcaagcccgccgcggcgccccgccaacgactc
tccgcgccccgcgcgcgccccgcggcgacgcgcgccgccgtcgtcgtcgaggcgaagaag
aaatccgtcggcgacctcgccgagagcgacctcaagggccaaaccgtgttcgtgcgatgc
gacctgaacgtgccgatggacgcggacctgaacatcacggacgacacgcgcattcgcgcg
gcgatcccgacgctcgagtacctggcgaagaacggcgccaaggtgctcgtgacgtcgcac
ttgggccgaccgaagaacggaccggaggataagttccgattgaccccggtcggggcgcga
ttgtccgagaagttgtcgtgcccggtgacgaaggtggacgactgcgtcggcgacgaagtc
gcgaaggcggtcgcgtccatgccgaacggctccgtgtgcttgctcgagaacacgcgcttc
tacaaggaagaagagaagaacgactctgacttcgcgaagaagctcgcgggcagcgcgacg
atcttcgtgaacgacgcgttcggaaccgcgcaccgcgcgcacgcctccaccgagggcgtg
accaagtactgcaagacgaacgtcgccggtttcttgctccaaaaggaactcgactacctc
gacggtgcggtctccaacccggaacgcccgttctgcgccatcgtcggtggctctaaggtg
tcctccaagatcggcgtcatcgagtccttgttgcaaaagacggacaagattatcctcggc
ggcggtatgattttcaccttctacaaggcgctcggcaagtccgtcggcgcgtccctcgtt
gaagacgacaagatcgacctcgccaaggaactcatggccaaggctgaagccaagggcgtg
aagatcttgctcccgaccgacgtcgtcgtcgcggacaagttcgccgaagatgccaagacg
caaatcgtctccgtcgacaacattccggaaggctggatgggtctcgacatcggtccggac
tccctcaaggcgttccaaggcgaactcaacgagtgcaagtccgtcatctggaacggtccg
atgggtgtgttcgaaatggacgccttcgccaagggtaccttcggtatcgccgacaccctc
gcgaacttgaacggcatcacgatcatcggtggtggcgactccgtcgccgccgtcgaaaag
gctggcctcgcggacaagatgtctcacatctccaccggcggtggtgcctccctcgaatta
ctcgagggcaaggtcttgccgggtgtcgccgccttggacgaagcgtaa

DBGET integrated database retrieval system