KEGG   Ostreococcus lucimarinus: OSTLU_30748Help
Entry
OSTLU_30748       CDS       T01029                                 

Gene name
HAG3502
Definition
(RefSeq) predicted protein
  KO
K11303  histone acetyltransferase 1 [EC:2.3.1.48]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     OSTLU_30748 (HAG3502)
Chromosome and associated proteins [BR:olu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    OSTLU_30748 (HAG3502)
   HAT complexes
    HATB complex
     OSTLU_30748 (HAG3502)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hat1_N Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 MOZ_SAS Herpes_UL37_1
Motif
Other DBs
NCBI-GeneID: 5000605
NCBI-ProteinID: XP_001417022
JGI: 30748
UniProt: A4RUU8
Position
3:complement(687539..689023)
Genome map
AA seq 494 aa AA seqDB search
MDDDQAAKRAKLAARFGDENADLGFAMPATVSASAQGLSTQTTTIDLNSKSNSCGAKIAK
KPIDAPVSYVCEAVDALKFHPWTPGSALETTRDDGDAFDAEFTHQVFREDESVFGYAGLA
LDVYVCRTSLRALLKMRYEKKISSAMNPADPVVEQMREWFDSDGLCELYEDEERFKREAG
MAEPCAGGTLVAESESDGVVTKITAYELATNEEARKWHAAMEAYAVFFIDAASKIDNSDS
RWTLLVATRHHADGRWETAGFTTVYRFYAYPDSERARLSQILVLPPYQRQGLGGKMLEAV
RKLAIDRSMRDLTIEDPTDQLQRLRDVHDVKACLKLPEMMAKVQSAAMDAARAQTDDARR
NALACTQHVFEMAAAKLKICKPQMRRIWEALLFIFAKRSNAPENSPVADAFKELIIRRLK
AMYTSNSDKDIGTKRIIPIGDNDFVMTKARGSAGEAPQMENPADGEADITEVLGELFQEC
AQNLSFIFAQCKDA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgatcaggcggcaaagcgcgcgaaactcgcggcgaggttcggcgatgaaaac
gccgatctcggtttcgcgatgccggcgacggtaagcgcgagcgcgcaggggctgtcgacg
cagacgacgacgatcgatttgaattcgaaatccaacagctgcggcgcgaaaatcgcgaag
aaaccgatcgatgcgccggtgtcgtacgtgtgcgaggccgtggatgcgttgaagtttcat
ccctggacgcctggaagcgcgttggagacgacgagggacgatggtgatgcgttcgacgcg
gagtttacgcatcaggtgtttcgcgaagatgagagcgtgttcggatacgcggggttggcg
ttggacgtgtacgtgtgcaggacatcgttgcgagcgctgttgaagatgagatacgaaaag
aaaatatcgagcgcgatgaatccggcggatcccgtggtggagcaaatgcgagagtggttt
gattcagatggattgtgcgagctgtacgaggatgaggagagatttaaacgcgaggcgggt
atggcagaaccatgcgctggtggcacgctggtggcagagagtgagagcgatggggtggtg
acaaaaatcactgcgtacgagttggcgacgaatgaggaggcgagaaagtggcacgccgcg
atggaggcgtacgcggtgtttttcatcgacgcggcgagcaagattgataactcagactcg
cgttggactctgctcgtggcgacgaggcatcacgccgatggacgctgggaaaccgctgga
tttacgacggtatatcggttctacgcctatcctgattccgagcgagcgcgattgagccag
attttggtgctccctccgtaccagcgacaaggcctcggtgggaagatgttggaagccgtt
cgcaagctcgcgattgatcgatcgatgcgagatttgacgattgaagaccccacagatcag
ttgcaacgattacgagacgtgcatgacgtcaaggcttgcttgaaactaccggagatgatg
gccaaggttcaaagtgcggcgatggacgccgcgcgagcgcagaccgacgacgctcgacgc
aacgcattggcctgcacgcagcacgttttcgaaatggctgccgcgaagctgaaaatttgc
aagcctcaaatgcgtcgtatctgggaagctttgctcttcatcttcgccaagcgttcaaat
gccccggagaatagccccgtggcggatgcgttcaaggaactcatcattcgtcggctcaag
gcgatgtatacgtcgaattccgacaaagatataggcaccaagcgcatcatcccgatcggt
gataacgatttcgtcatgaccaaagcgcgaggttccgccggtgaggcgccgcagatggaa
aatcccgcagatggtgaggctgacatcaccgaagttttaggcgaactctttcaagagtgc
gcgcaaaatttgagtttcatctttgcgcagtgcaaagacgcgtga

DBGET integrated database retrieval system