KEGG   Ostreococcus lucimarinus: OSTLU_30915Help
Entry
OSTLU_30915       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00020  Citrate cycle (TCA cycle)
olu00640  Propanoate metabolism
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
olu01200  Carbon metabolism
Module
olu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
olu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:olu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OSTLU_30915
   00640 Propanoate metabolism
    OSTLU_30915
Enzymes [BR:olu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     OSTLU_30915
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     OSTLU_30915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 TraV
Motif
Other DBs
NCBI-GeneID: 5000673
NCBI-ProteinID: XP_001416813
JGI: 30915
UniProt: A4RVB5
Position
3:971664..972698
Genome map
AA seq 344 aa AA seqDB search
MRRTSIKSLIERASAASAASAVARAARAAFTSSSTASVRASSSSHADSPAVFVDKNTRVI
VQGFTGKNGTFHSEQAIAYGTQVVGGVTPRKGGTTHLNLPVFDTVREAKESTKANASVIY
VPPPFAARAVMEAIEAEVELVVCITEGIPQHDMVRVKQALMSQSKTRLIGPNCPGIIKPG
ECKIGIMPGYIHKPGRVGVVSRSGTLTYEAVYQTTVAGLGQSTCVGIGGDPFNGTNFVDC
LEKFVKDPQTEGIIMIGEIGGTAEEEAAEFIRASGTEKPIVSFIAGLTAPPGRRMGHAGA
IISGGKGSAGDKIAALERVGVRVVKSPAKMGQAMYEMFGERNML
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgaacgtcgatcaagtcgttgatcgagcgcgcgagcgcggcgagcgcggcgagc
gcggtcgcgcgcgcggcgcgcgcggcgttcacgtcgtcgtcaacggcatcggtgcgcgca
tcgtcgtcgtcgcacgccgactcgccggcggtgttcgtcgacaagaacacgcgcgtgata
gtgcaagggttcacgggcaagaatggcacgtttcacagcgaacaggcgatcgcgtacggg
acgcaagtcgtgggcggggtgacgccgcgcaagggcggaacgacgcacttgaatctgccc
gtgttcgacaccgtgcgagaggcgaaagagagcacgaaagccaacgcgagcgtgatttat
gtcccaccaccgttcgcggcgcgggcggtgatggaggccatagaggcggaagtcgagctc
gtcgtgtgcatcacggaggggattccgcaacacgacatggtgcgagtcaaacaggcgctg
atgtcgcaaagcaaaacgcgattgatcgggccgaactgcccgggaatcatcaaacccggc
gagtgtaagattggaatcatgcctggatacattcacaagccaggacgcgtgggcgtggtt
tcacgaagcgggacgttgacgtacgaggcggtgtatcagacgaccgtcgcgggactcggg
cagagcacatgcgtggggatcgggggcgaccctttcaacggcactaatttcgtcgattgt
ctggagaagttcgtcaaggatccgcagacggaaggcatcatcatgatcggcgagatcggc
ggcaccgcggaagaggaagcggcggagtttattcgcgcgagcggtaccgaaaagccgatt
gtatccttcatcgcggggctcaccgcacccccaggcaggcgtatgggtcacgccggagcg
atcatatcaggcggtaagggtagcgcaggcgataaaatcgccgcgctcgaacgcgtcggc
gttcgcgtcgtcaagtcgccggcgaagatgggccaggcgatgtacgaaatgtttggcgaa
cgaaacatgctgtaa

DBGET integrated database retrieval system