KEGG   Ostreococcus lucimarinus: OSTLU_31015Help
Entry
OSTLU_31015       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K14289  exportin-5
Organism
olu  Ostreococcus lucimarinus
Pathway
olu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:olu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    OSTLU_31015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:olu03016]
    OSTLU_31015
   03036 Chromosome and associated proteins [BR:olu03036]
    OSTLU_31015
Transfer RNA biogenesis [BR:olu03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    OSTLU_31015
Chromosome and associated proteins [BR:olu03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     OSTLU_31015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Xpo1
Motif
Other DBs
NCBI-GeneID: 5001418
NCBI-ProteinID: XP_001417160
JGI: 31015
UniProt: A4RVL3
Position
4:join(160993..161613,161834..163012,163254..165044)
Genome map
AA seq 1196 aa AA seqDB search
MEACRSLCARGRGLEARHFGFGVLRDVARTRWRGLTAEERMEMASLAHGMLLEVSAGDAA
EAYAVKSKAATLVAETVRQEGASLWTRLVPDLVSMTTGDEAQRAEMGVNVIRYVAEDVAV
YNEDMIGGKMRELLGGLSSTVGTILPAIYALMEKHYTKATAATDREVAKRHAAAVNAALG
AAAVYSEWAPLAPIMRSGLIEACGMLLASDEFRCAACDALRHVVARRANVAQGVDEQDDQ
DIIKGLTLAANAMSTAAERVISHPNQADLVSDPEEVMFIKRLGETMASMAGYHLSTITDE
STRNVFLERLMGLSRFPSLEVLDVVIGAWPVMLRAMGAELPKTFVRGPPSQGVNNPYNAQ
KLEPNGILPMGAPEVLLEISRVWLNAGAGIASGFDTNGIPGNKAEDWADEFESVVELRET
WVQLRAKWMDITKLCTALCPSSAANQASQNTLMVISWTQPGGPLANSSDETKCAALEGAT
SFLEAIMVALPTEGPSFMGFASTLEALLGQLVAIDFKAPLSNAQVSKLLETFGKFARARP
EVALTIMSRLFTILNELPADVQSGAPPVRQRDIVASGRTGQAARQKVCAAILIVCSAAPT
ALNPHLEAFASQIETMKSSGRLSGAERGSLAEALLAVAGPSGAQRVREVLEWLLSSVRNR
WVPGGALSPEVEHLLAISTMAAGEAAGGTQGLSSAHWELFHDVQLTERCLRRSLGDAETA
KVPTGLMKPVDPPPPISECPAVDHMEWAVSLVSCLARRIHSYWTPQGSAAMHSCQLGAAL
GMSPEEKAAYLIHGPARTQVLNEEEPGTSTTASASRDWMRCLRDCSYSVFALFSIHAPAA
FYPNQALASACGGSMLADLPYMELRHVRQVVHAAVRPIMGRCPAAHRAMWQTALVNPLCA
ALHDRLAKEWANTRVVNATKAQERGDEDDETDGVEVNDLISERILRDITRDHCAMLAIVA
APEGTFGRKTKGSGLTGVMGDMSNTLLGTSYAGGKHILDWIAHGDANAIRAGIATGAAAL
TWEDAESTGHAVNFVRGLCAAAGSANAPQALRDNVGSDVFQATLVALTQSSNAAHQADIL
GLIRDIIIWLTPKTQSVVQILMSLPGMTQQALDSCVRELGAMRSEKKAANFVKDFLINAS
GGGEELRALVEARSQTNKSGVAIQIPKTAPRNPVKQSTSPDNHGFSAEAASNAIGL
NT seq 3591 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgtgtcgatcgctgtgcgcgcggggacgcgggctcgaggcgcgacacttcggc
ttcggcgtgctgcgggacgtggcgcggacgcgctggcgagggctgacggcggaggagcgg
atggagatggcgagcttggcgcacgggatgctgctggaggtgagcgcgggagacgcggcg
gaggcgtacgcggtgaaatcaaaggcggcgacgctcgtggcggagacggtgcggcaggag
ggcgcgagtctgtggacgaggttggtgccggatttggtgagcatgacgacgggggacgag
gcgcagagggcggagatgggggtgaacgtcatacggtacgtcgcggaggacgtggcggtg
tataacgaggacatgataggtgggaagatgcgagagttgttgggcgggttgtcgagcacg
gtggggacgattttgccggcgatttacgcgctgatggagaagcattacaccaaggcgacc
gcggcgacggatcgcgaggtggcgaaaaggcacgccgcggcggtgaatgcggcgctcggg
gcggctgcggtgtacagcgagtgggctccgttggcgccaatcatgcggagcggtttgatc
gaggcgtgtgggatgctcttggcgagcgatgaatttcgttgcgcggcgtgcgatgctttg
agacacgtcgtcgctcgccgtgccaacgtcgcgcaaggcgtggacgagcaagatgatcag
gatatcatcaagggtttgacgctcgcggcgaacgcgatgtccacggcggcggaacgcgtg
atttcgcacccgaaccaagccgatctcgtgagcgatccagaagaagtcatgttcatcaag
agactgggtgagacgatggcatcgatggcggggtaccatctcagcacgatcacggacgag
agcacgcgtaacgtgttcctcgagcgattgatggggctgtcgcgatttcctagtttggag
gttttggacgtcgttatcggcgcgtggccggtgatgctccgcgccatgggtgccgagctt
cccaagacgttcgtgcgaggaccaccgtcgcaaggagttaataatccatacaacgcgcaa
aagctcgagccgaacgggattcttcccatgggcgctcccgaggttttgctcgaaatctcg
cgcgtgtggctcaacgccggcgcgggcatcgcctctgggtttgacaccaatggtattccg
ggtaataaagcggaagattgggccgatgaattcgaaagcgtggtagagcttcgcgagacg
tgggtgcagcttcgggcgaaatggatggacatcaccaagttgtgcacggcgttgtgtccg
agcagcgcggcgaatcaagcgtcgcaaaacacgctgatggtgatttcgtggacgcaacca
ggcggacctttggcgaatagctcggatgaaacgaaatgcgcggctctggagggtgcgacg
tcgtttttagaagccatcatggtcgctcttccgaccgagggtccgtcgtttatgggcttc
gctagcacgttggaggcgctcctcggccagctcgtggcgattgacttcaaggcgccgctg
agcaacgcgcaggtgtccaaattgctcgaaacgttcggcaagtttgcccgggcgcgtcca
gaagtggctctgacgataatgagtcgactttttacgattttgaatgaattgcccgccgac
gtacaatctggagcgccgccggtgcggcagcgcgacatcgtcgcgagcgggcgcacgggc
caggcggcgagacaaaaagtgtgcgcggcgattctcatagtttgttcagcggccccaacg
gctttgaacccacatctggaggcttttgcctctcaaatcgaaaccatgaaatcttccgga
cgactgagcggcgccgagcgaggttcgctcgccgaggcgctcctcgcggttgctgggccg
tccggcgcgcagcgcgtgcgcgaagttctcgagtggctgctgtcatccgtccgaaataga
tgggttcctgggggtgcgctctcgccagaggttgagcatctgttggccatttctacgatg
gcggcgggcgaagccgccggcggaacgcaaggcttgtcgtcggcgcactgggagctgttt
cacgacgtacaactcaccgagcgttgtcttcgacggagtttgggtgatgcggaaacagct
aaagtaccgacaggtttgatgaagcccgtggacccaccgccaccgatatcggaatgtccg
gcagtggatcatatggaatgggccgtctcgctcgtctcgtgcttggcgcgaagaattcac
tcgtactggactccgcaagggagcgcggcgatgcacagttgccaattaggcgcggcgctt
ggaatgagccccgaagagaaggcggcgtatttgattcacggtccggcgcgaacgcaagtt
ctcaacgaggaagaacccgggacgagcacgacggcgagcgcgtctcgcgattggatgcga
tgcctgcgcgattgctcgtactcggtcttcgcgttgttcagcattcacgctcccgcggca
ttttacccgaaccaagccttagcgagcgcgtgtggtgggtctatgttagctgatctgccg
tacatggagctcaggcacgttcgtcaagtcgtgcacgcggcggtgcgaccgatcatgggg
cggtgtccggcggcgcatcgcgcgatgtggcagacggcgctcgtgaacccgctgtgcgcg
gcgctgcacgaccgcctcgccaaggaatgggcgaacacgcgcgtggtgaacgcgaccaag
gcgcaagaaagaggagatgaagacgacgagacggatggcgtcgaggtgaatgatttgatt
tctgaacgaattcttcgcgacatcacgcgggaccactgcgcgatgctcgccatcgtcgcg
gctcccgaaggcacgttcgggcgcaagaccaaagggagtgggttgactggtgtcatgggt
gatatgtcaaacacgctattagggacatcgtacgccggagggaaacacatattggattgg
atcgcgcacggtgacgctaacgcgattcgcgccggcatcgccacgggggccgccgcgctc
acgtgggaagacgcggaatccaccggccacgccgtgaactttgtgcgcgggctgtgtgcc
gccgccgggagcgcgaacgcaccgcaagcgttgcgagacaacgtcggttcagatgtcttc
caagccaccctcgtggcgctgacgcaaagctccaacgccgcgcaccaagccgacattctc
ggcttgattcgcgacatcatcatttggctcaccccgaagacgcaatccgtggtacaaatc
ttgatgagtcttcccggaatgacgcagcaagccctcgattcatgcgtgcgagagctcggt
gccatgcgaagcgagaagaaagccgctaatttcgtcaaggacttcttaatcaacgccagc
ggaggaggagaagagcttcgcgccctcgtcgaggcgcgttcgcaaaccaacaagagcggc
gtcgcgattcaaataccgaagaccgccccgcgaaatccagtgaagcaatcgacgagtccg
gacaatcacggtttctccgccgaggcggcgtccaacgcgatcggactgtga

DBGET integrated database retrieval system