KEGG   Ostreococcus lucimarinus: OSTLU_31367Help
Entry
OSTLU_31367       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00020  Citrate cycle (TCA cycle)
olu00640  Propanoate metabolism
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
olu01200  Carbon metabolism
Module
olu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
olu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:olu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OSTLU_31367
   00640 Propanoate metabolism
    OSTLU_31367
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:olu04147]
    OSTLU_31367
Enzymes [BR:olu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     OSTLU_31367
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     OSTLU_31367
Exosome [BR:olu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OSTLU_31367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 5001242
NCBI-ProteinID: XP_001417593
JGI: 31367
UniProt: A4RWK4
Position
4:complement(758683..759945)
Genome map
AA seq 420 aa AA seqDB search
MSRAIAIAIARRATRERAPWTRVARRALHVHEYQGAEIMKKFGVRVPIGAACGTLDEVDD
AARAMRGDEVVVKSQILAGGRGLGTFASGFEGGVHAVAKTRARETAAKMLGGTLVTKQSG
PAGKPVNVVYVAEKMTLTREMYFAITLDRASAGPLVIASAEGGTSIEDLAQSHPEKIIKM
RLDIERGMTKTQADELVKRLGILKHVDEAAKQLMGLYETFSKTDCTMIEVNPLAEDQDGR
VVAADAKLNFDDNAEYRQSELFSLRDTSQEDPREVQASKFDLNYIGLDGNIGCMVNGAGL
AMATMDIIQLYGGSPANFLDVGGNASEEQVVEAFKILTADPKVQAILVNIFGGIMKCDVI
AAGIVAAAKQVDLKVPLIVRLEGTNVEAGNKILKSSGMTIVTAEDLDDAAQKACASLSAR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcgcgatcgcgatcgcgatcgcgcgacgcgcgacgcgcgaacgcgcgccgtgg
acgcgcgtcgcgcggcgcgcgctgcacgtgcacgagtaccaaggcgcggaaatcatgaag
aagtttggcgtgcgcgtgccgatcggcgcggcgtgcgggacgctggacgaggtcgacgac
gccgcgcgcgcgatgcgcggagacgaggtggtggtgaagtcgcagatcctcgccggtggg
cgcggactcgggacgttcgcgagcgggttcgagggaggggtgcacgcggtggcgaagacg
cgcgcgcgagagacggcggcgaagatgctgggggggacgttggtgacgaaacagagcgga
ccggcggggaaaccggtgaacgtggtgtacgtggcggagaaaatgacgctgacgcgggag
atgtacttcgcgatcacgctcgatagggcgagcgcgggaccgttggtgatcgcgagcgcg
gagggcggcacgtcgatcgaggacttggcgcagagtcatccggagaagattattaagatg
cggttggacatcgagcgcgggatgacgaagacgcaggcggacgagctggtgaaacgactc
ggaattttgaaacacgtcgatgaggcggcgaaacaactcatggggttgtacgaaacgttc
tccaagaccgactgcacgatgatcgaggtgaatccgctcgcggaggatcaagacggacgc
gtcgtcgccgcggacgccaagttaaacttcgacgacaacgccgaatatcgacagagcgag
ttgttctcccttcgcgatacatcgcaggaagatccgcgcgaggtgcaggcgagcaaattc
gacttgaactacatcggattggacggcaacatcggatgcatggtgaacggagcgggtttg
gccatggcgaccatggacatcatccaactctacggaggttcgcccgcgaatttcctcgac
gtcggcgggaacgcgagcgaagagcaagtcgtcgaagctttcaagattttgaccgccgac
ccgaaagttcaagccatcttggtgaacattttcggcggcatcatgaagtgcgacgtcatc
gccgccggcatcgtcgccgcggccaagcaagtcgatctcaaagtcccgctcatcgtgcga
ttagagggaacgaacgtcgaggctgggaacaagattctcaagtcgtccgggatgaccatc
gtcaccgccgaagacctcgacgacgccgcgcaaaaagcgtgcgccagtctctccgcgcgt
tga

DBGET integrated database retrieval system