KEGG   Ostreococcus lucimarinus: OSTLU_32358Help
Entry
OSTLU_32358       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
olu01230  Biosynthesis of amino acids
Module
olu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OSTLU_32358
Enzymes [BR:olu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     OSTLU_32358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-GeneID: 5002370
NCBI-ProteinID: XP_001418562
JGI: 32358
UniProt: A4RZE7
Position
6:complement(730566..731633)
Genome map
AA seq 355 aa AA seqDB search
MSAATGRATLATGARRDARRARRATRPRASAPSGVDDGAVSIRRRPPNGPSKHDLGVGQF
EFVIEEVAPTGERVTNENNKPKNILEEIVWYKDVELAERKEKFPLQLVRTALVNAPPTRD
FVKAITDQLAATKQPGLIAEVKKASPSKGVIQPNFDPVKIAKAYEEGGAACLSVLTDEKF
FQGGFENLALIREAGVTCPLLCKEFIVDAYQIYLARKYGADAILLIAAVLPNQDLKYFIK
IAHSLGMKCLIEVHTYGEMKRVLDGDFPIDLLGINNRDLGTFEVSLSVTTDLMNGPLGEE
VKRRGITMVGESGIFTIDDVNLLQDSGVGAVLVGESLVKQDTPDVGIKKLFGRPV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgcgacgggacgcgcgacgctcgcgacgggcgcgcgacgggacgcgcgacgc
gcgcgacgcgcgacgcgcccgcgcgcgagcgcgccctcgggcgtggacgacggcgcggtg
agcatccgacgacgaccgccgaacggaccgtccaagcacgacctgggcgtcggacagttt
gagttcgtgatcgaggaagtcgcgccgacgggcgagcgggtgacgaacgagaacaacaag
ccgaagaacatcttggaggagatcgtgtggtataaagacgtggaactcgcggaacgcaag
gagaaattcccgttgcagttggtgcgaacggcgctggtgaacgcgccgccgacgagggat
tttgtgaaggcgatcacggatcagttggcggcgacgaaacagccgggactgatcgcggag
gtgaagaaggcgtcgccgtcgaagggggtgattcagccgaattttgatccggtgaaaatc
gcgaaggcgtacgaggagggtggggcggcgtgtttgagcgtgttgacggatgaaaagttc
tttcagggtggatttgaaaacttggcgctcattcgcgaggctggggtgacgtgcccgttg
ctctgcaaggagttcatcgtggacgcgtatcaaatttatctcgcgcgcaagtacggcgcc
gacgcgattttgttgatcgccgcggttttgcccaaccaagatttgaagtacttcattaag
attgcgcactcgctgggcatgaagtgcttgatcgaggtgcacacgtacggggagatgaag
cgcgtgttggacggagactttcccatcgatttgctcggcatcaacaaccgggatttggga
acgtttgaggtcagcttgagcgtcaccaccgatctcatgaacgggccgctcggcgaggag
gttaagagacgcggcatcaccatggttggcgagtctggaatcttcaccatcgacgacgtc
aacttgttgcaagattccggcgtcggcgcggtcttggtcggcgagtccctcgtcaagcag
gacaccccggacgtcggcatcaagaaattgttcggccgcccggtgtga

DBGET integrated database retrieval system