KEGG   Ostreococcus lucimarinus: OSTLU_32608Help
Entry
OSTLU_32608       CDS       T01029                                 

Gene name
rbcL
Definition
(RefSeq) predicted protein
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00630  Glyoxylate and dicarboxylate metabolism
olu00710  Carbon fixation in photosynthetic organisms
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
olu01200  Carbon metabolism
Module
olu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
olu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:olu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OSTLU_32608 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OSTLU_32608 (rbcL)
Enzymes [BR:olu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     OSTLU_32608 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large
Motif
Other DBs
NCBI-GeneID: 5002752
NCBI-ProteinID: XP_001418678
JGI: 32608
UniProt: A4S040
Position
7:344911..346950
Genome map
AA seq 679 aa AA seqDB search
MAPKSFEDMFACSPASLTKLRASHAPHASPAASHARDYSPIAFPSMRRDDEDERARAVAG
AFDDMFACSPASLKKMRGSAVERASGGVGTPTGTPTRPTASREDLASAFGDMFLASPASL
KKMRATNTAVTGTKARERGDGFGSPLRYDGDANAAEPKKEAVSFSEMFASSPSDLAKMRR
SDVGGAARGSNVEVAKVAVDARERTNAFAGMFASSPADLAKMRGRSQSSISYAEGRHGAS
DRFQVIAPDFQAMFSSSPSDLKNLRSASSSSRKRLGDEADRFEVTYLLLAPCEAAAREKV
LEICLEQTVELPASLVPEGTWIREHVVGRLESLTKPKTGPHARRPDAWNAIVSYHADTAG
GELTQLVNVIFGNTSMKENVMVVDIELPRTMLREYPGPRFGVHGLRRLLRVPEGPLVMTA
LKPMGLSSQELAEIAYGFAKGGIDIIKDDHGLADQPYSPYDERVRMCAAAVARANAETGR
NVLYAPCINAPAHLIISRAHAARQAGAGAVLMIPGITGLDAMRELAADPSFNLPIIAHPA
LLGCMLGGGSTNRIAGFSHEVLLGLLPRLAGADATVFPSFGGRFGFSVDECKAINVGCTR
VMGDLPAILPSPGGGMTLERIAQMREVYGPDLLLLIGGSLYSHSENLVDGARHFMKLAGR
KELYGPLECPHDGYRGHTM
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaagtcgttcgaagacatgttcgcgtgctcgcccgcgtcgctgaccaagctc
agggcgtcgcacgcaccgcacgcgtcgccggcggcgtcgcacgcgcgtgactactcgccc
atcgcgttcccgtcgatgcgtcgagacgacgaagacgaacgcgcgcgcgcggtcgcgggc
gcgttcgatgacatgttcgcgtgttcgccggcgtcgctgaagaagatgcgaggatcggca
gtggagcgggcgtcgggaggggtcgggacgccgacggggacgccgacgcggccgacggcg
agtcgcgaggatttagcgtcggcgttcggcgatatgtttttagcgtctccggcatcgttg
aagaagatgcgcgccacgaatacggcggtgacgggaacgaaggcgcgcgagcgtggggat
ggattcggatcgcccttgcgttacgacggcgacgcgaacgcggcggagccgaagaaggaa
gcggtgagtttcagtgaaatgttcgcaagttctccctcggatttggccaagatgcgacgg
tcggacgtcggtggtgccgcgcgcggatctaatgtggaggttgctaaggtggcagtggac
gcgcgagagcgcacgaatgcgttcgcaggcatgtttgccagttcaccggcggatttggcc
aagatgcgcgggaggtcgcagtcgtcgatttcttacgccgaagggcggcacggcgcgagc
gatcgatttcaggttatcgcgcctgattttcaagccatgttttctagttcgccgagcgat
ttgaaaaacttgagaagcgcgtcgtcgtcgtcgaggaagaggctcggcgacgaagctgat
agatttgaggtgacgtacttgctcctcgccccttgcgaagcggcagctcgagagaaggtt
ttagaaatttgtttggaacagactgtggagttaccagcgtcgctcgtgccggaagggact
tggattcgagagcatgtcgtcggtcgattggagtctttgacgaagccgaagaccggaccg
cacgcccgtcgtccggacgcgtggaacgcgattgtcagctaccacgccgacactgcgggt
ggggagttaacacagcttgtgaacgtcatcttcggcaacacgagcatgaaggagaacgtg
atggtcgtcgatatcgaactacctcgcaccatgctgcgcgagtaccctgggccacgattc
ggcgttcacggtcttcgtcgtttgctccgcgtacccgaagggcctctggtgatgacggca
ctcaaaccaatgggattgtctagccaagaattagcagaaattgcgtacggtttcgccaag
ggagggatcgacatcatcaaggatgaccacggactcgcagaccagccgtacagcccttac
gacgagcgagttcgaatgtgcgctgccgctgtagcgcgcgccaacgcagagaccggtcga
aacgttctctacgccccgtgtatcaacgctcccgcgcatttaatcatttctcgagcgcac
gctgcgagacaggcgggcgcgggcgcggtgttgatgattcccggcattacgggtttggac
gccatgcgtgagctcgctgcagacccgagcttcaacctccccatcatcgctcatcccgcg
ttgctcgggtgcatgctaggcggagggagcacaaatagaatagcgggctttagtcatgaa
gtccttctcgggttattaccgcggttggccggtgcggacgccaccgtcttcccgtccttt
ggcgggcggtttggattcagcgtggacgaatgcaaggccatcaacgtcgggtgcacgcgg
gtgatgggagatttgcccgccattttaccctctccgggcggtggcatgacgctcgagcgc
atcgctcagatgcgcgaggtgtacggccccgatttattacttctcatcggcggttctttg
tactcgcactcggaaaatctcgtcgacggcgctcgtcacttcatgaaactcgccggacgc
aaagagctctacggtccgctcgagtgcccgcacgacggttaccgcggacatacgatgtga

DBGET integrated database retrieval system