KEGG   Ostreococcus lucimarinus: OSTLU_32688Help
Entry
OSTLU_32688       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00260  Glycine, serine and threonine metabolism
olu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
olu01230  Biosynthesis of amino acids
Module
olu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OSTLU_32688
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OSTLU_32688
Enzymes [BR:olu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OSTLU_32688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 5002734
NCBI-ProteinID: XP_001418947
JGI: 32688
UniProt: A4S0C1
Position
7:complement(482691..483944)
Genome map
AA seq 417 aa AA seqDB search
MTPPTQGKISEQSRPDANGRYGAYGGKYVPETLIPALRALEKEYEAIKTDPAFQAELKDI
LKDYVGRENPLYYAERLSEHFKDANGEGPDVYLKREDLNHTGAHKINNAVGQALLAKRMG
KKRIIAETGAGQHGVATATVCARFGLECIIYMGAADMERQKLNVFRMRLLGATVRPVRAG
TATLKDATSEAIRDWVTNVEDTHYILGSVAGPHPYPMMVRDFHAVIGQETRRQAMEKWGG
LPDILVACVGGGSNAMGLFHEFIDDESVRIIGVEAGGEGIEPGQKHAATLTLGTPGVLHG
SFSYLIQDEEGQIVEPHSISAGLDYPGIGPEHAFLKDFGRAEYHAITDKEALDAFVATSR
LEGIIPALETSHALAYLWKLCPGLPNGTKVVLNCSGRGDKDVNTAAKFLDISGEVDG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgccgacgcaggggaagatctcggagcagtcgcgaccggacgcgaacgggagg
tacggcgcgtacggggggaagtacgtgccggagacgctgatcccggcgctgcgggcgctg
gagaaggagtacgaggcgatcaagacggacccggcgttccaggcggagctgaaggatatt
ctgaaggattacgtcggacgcgagaatccgctgtactacgccgaaaggttgagcgaacac
ttcaaggacgcgaacggggaagggccggacgtgtacctgaagcgcgaagacctgaaccac
acgggggcgcacaagatcaacaacgcggtcgggcaagcgctgttggcgaagcgaatgggg
aagaagcgcatcatcgctgagaccggggcgggacaacacggcgtggcgacggcgacggtg
tgcgcgcgattcgggttggagtgtatcatttacatgggcgcggcggatatggagcgacaa
aagctcaacgtgttccgcatgcgtttgctcggcgccacggttcgaccggtgcgcgcgggc
acggccacgctcaaggatgcgacgtctgaggctattcgtgactgggtgacgaacgttgag
gacacgcactacatcctcggctcggtcgcgggcccgcacccgtatccgatgatggtgcgc
gacttccacgccgtcatcggtcaagagactagaagacaagccatggagaaatggggcggt
ttgccggacatcctcgtcgcgtgcgttggcggtggctccaacgccatgggtctgttccac
gagttcatcgacgacgaatccgtgcgcatcatcggcgtcgaagccggcggcgaaggcatc
gagccgggccaaaagcacgccgcgacgctcaccttgggcaccccgggcgtgcttcacggc
tcgttctcgtacttgattcaagatgaagagggtcaaatcgttgagccgcactccatctcc
gccggtctcgattacccgggcatcggtccggagcacgccttcttgaaggatttcggtcgc
gccgagtaccacgccatcaccgacaaggaagcgctcgacgctttcgtcgccacctctcgt
ctcgagggtatcatccctgcccttgaaacgtcccacgccttggcgtacttgtggaagctc
tgccctggtctccccaacggcaccaaggttgtcctcaactgcagcggccgcggcgacaag
gacgtcaacaccgccgccaagtttttggacatcagcggtgaggtcgacgggtga

DBGET integrated database retrieval system