KEGG   Ostreococcus lucimarinus: OSTLU_33121Help
Entry
OSTLU_33121       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00260  Glycine, serine and threonine metabolism
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
olu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:olu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OSTLU_33121
Enzymes [BR:olu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     OSTLU_33121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Pyridoxal_deC Cys_Met_Meta_PP Aminotran_3 DUF659
Motif
Other DBs
NCBI-GeneID: 5003216
NCBI-ProteinID: XP_001419158
JGI: 33121
UniProt: A4S1J4
Position
8:423194..424300
Genome map
AA seq 368 aa AA seqDB search
MRLSDGVVDARSDTVTKPTARMREAMARAEVGDDVLGDDRTVKALERKMAEMFGFEAAVF
TPSGTMANLLAIATWCDERGSEAIIGDKSHVHLYEQGGMSSLMGVHSRTLKNREDGTLAL
EDIRAAIRTVSDDHFPVTKVVTLENTQNKCGGKVLPVEYVREVGALCAAHGVKLHMDGAR
IWNALAASIDHVRIDHILQGCDSASICLSKAIGAPVGSVLLGDEAFVRKAKRLRKALGGS
MRQVGVLAAAALEAIDEVFPKIAEDHERARAFANALQGATGLECATPESNLVLVRSTIPG
ITSEMLMRELEMSHGVLVLPTNQDTIRVAFHHQITDAGVERLVSGFRESVLELARDPKLN
EIMMSDGM
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcgactctccgacggcgtcgtcgacgcgcggagcgacacggtgacgaaaccgacggcg
cgcatgagggaagcgatggcgcgcgccgaggtcggggacgacgtcctcggcgacgatcgc
acggtgaaggcgctcgaacgtaaaatggcggagatgtttggattcgaggcggcggtgttc
acgccgagcggaaccatggcgaatttgctcgccatcgccacgtggtgcgacgagcgaggg
agcgaagcgatcatcggagataagtcgcacgtgcacctgtacgaacagggcgggatgtcg
tcgctgatgggggtgcattcgagaacgctcaagaatcgcgaagacgggacgctcgcgctg
gaggatatacgagccgcgatacgcaccgtgagcgacgatcacttcccagtgacgaaggtt
gtgacgctggagaacacgcagaataagtgtggggggaaggtactgccggtggagtacgtt
cgggaggttggggcgttgtgcgcggcgcacggggtgaagttgcacatggacggggcgaga
atttggaacgcgttggcggcgagcatcgatcacgttcgcatcgatcacatcttacaaggg
tgtgattcggcgagtatctgcttgagcaaagccatcggcgcccccgttgggagcgtgtta
ctcggcgatgaggcgtttgttcgaaaggcgaagcggttgcgcaaagcgttgggcggttcg
atgcgacaagtcggcgtcttagccgctgcggctttagaggcgatcgatgaagtattcccg
aagatagcagaagatcacgagcgcgcgagggctttcgcgaacgcgctacaaggcgcgact
ggtctcgaatgcgcaacgccggagtcgaacctcgttctcgtgcgaagcaccattcccggc
atcacttccgagatgttgatgcgggaattggagatgagccacggtgtgttggttttacca
acgaatcaagacaccattcgcgtcgcttttcaccatcaaatcacggatgcgggcgttgaa
cgtctggtcagtggctttcgtgaaagcgtgctcgaactcgctcgcgacccaaagctgaac
gaaattatgatgtctgacggtatgtaa

DBGET integrated database retrieval system