KEGG   Ostreococcus lucimarinus: OSTLU_33239Help
Entry
OSTLU_33239       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K07374  tubulin alpha
Organism
olu  Ostreococcus lucimarinus
Pathway
olu04145  Phagosome
Brite
KEGG Orthology (KO) [BR:olu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    OSTLU_33239
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:olu03019]
    OSTLU_33239
   03036 Chromosome and associated proteins [BR:olu03036]
    OSTLU_33239
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:olu04812]
    OSTLU_33239
   04147 Exosome [BR:olu04147]
    OSTLU_33239
Messenger RNA biogenesis [BR:olu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     OSTLU_33239
Chromosome and associated proteins [BR:olu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     OSTLU_33239
Cytoskeleton proteins [BR:olu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    OSTLU_33239
Exosome [BR:olu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   OSTLU_33239
  Exosomal proteins of other body fluids (saliva and urine)
   OSTLU_33239
  Exosomal proteins of colorectal cancer cells
   OSTLU_33239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Motif
Other DBs
NCBI-GeneID: 5003213
NCBI-ProteinID: XP_001419217
JGI: 33239
UniProt: A4S1W0
Position
8:join(607007..607104,607293..608553)
Genome map
AA seq 452 aa AA seqDB search
MREVISIHIGQAGVQTGNSCWELYCLEHGIQPDGQMPSDKTIGASDDAFNTFFSETGAGK
HVPRCIFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLALD
RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
VVEPYNSVLSTHALLEHTDVAVMLDNEAVYDICRRSLDIERPTYTNLNRLIAQVISSLTA
SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEVTNSAFEPAS
MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTRRTIQFVDWCPTGFKCGINYQPP
TVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGSSSQSGVSDFVEETEY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaggtgatctccattcacatcggtcaagccggggtgcaaaccgggaactcgtgc
tgggagttgtactgcctcgaacacgggatccagccggatgggcaaatgccgagcgacaag
acgatcggggcgtctgatgacgcgttcaacacgttcttctccgagaccggcgccgggaag
cacgtgccgcgatgcatctttctcgatctcgagccgacggtgatcgacgaggtgcgcacg
ggggcgtaccgtcagctgttccaccccgagcagttgatctcgggcaaggaagacgccgcg
aataactttgcgcgcggtcactacacgatcggcaaggaaatcgtggacttggccctcgat
cgcattcgtaagttggcggacaactgcacgggtttgcaaggctttttggtcttcaacgcc
gtcggcggcggcacgggttcgggtctcggctcgttgctcctcgagcgcttgtccgtggat
tacggcaaaaagtccaagctcgggttcaccatctacccctcgccgcaagtctccaccgcg
gtggtggagccgtacaactctgtgctgtccacgcacgcgctgctcgagcacaccgacgtc
gcggtgatgttggacaacgaagccgtgtacgacatctgccgcaggtctttggacatcgag
cgcccgacgtacaccaacttgaaccgcttgatcgcgcaggtcatctcttcgctcaccgcg
tctctgcgattcgacggcgcgttgaacgtcgacgtcacggaattccaaaccaacttggtg
ccgtacccgcgcattcacttcatgttgtcgagctacgccccggtgatctccgccgagaag
gcgtaccacgagcagttgtccgtcgcggaggtgacgaacagcgcgttcgaaccggcgagc
atgatggccaagtgcgacccgcgtcacggcaagtacatggcgtgctgcttgatgtaccgc
ggcgacgtcgtgcccaaggacgtcaacgccgccgtggcgagcatcaagaccaggcgcacg
attcaattcgtcgattggtgcccgaccgggttcaagtgcgggatcaactaccaaccgccg
accgtcgtgccgggtggcgatctcgccaaggtgcaacgcgccgtgtgcatgatttccaac
tcgacggccatcgccgaagtgttttcgcgactcgaccacaagtttgacttgatgtacgcg
aagcgcgcgttcgtgcattggtacgtcggcgagggcatggaggagggcgagttctcagag
gcacgggaagatctcgcggcgcttgaaaaagattatgaagaagttggatcatcatcgcaa
tctggtgtttcagattttgtcgaagagacggagtactga

DBGET integrated database retrieval system