KEGG   Ostreococcus lucimarinus: OSTLU_33884Help
Entry
OSTLU_33884       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
olu  Ostreococcus lucimarinus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Motif
Other DBs
NCBI-GeneID: 5000994
NCBI-ProteinID: XP_001416754
JGI: 33884
UniProt: A4RUZ4
Position
3:761108..761926
Genome map
AA seq 272 aa AA seqDB search
MGGRGCAFVRVRARSRRRTREGNARGARGEESPEREGAARRRAATRTRLTNARANRPQTP
TVPIPGGEGGGVNYPAWATTEPALVPVAINWTQGGNSVEVEGSFDNWQSRQTLHRSGNRE
FAIVMSLRPGVYQYKFIVDGQWKYAPDQPAMYDEIGNVNNVLEVQEYVPEILDSLDAFTA
PASPPASYDCAPFNSDDFAKEPPPLPPQLHMTLLNMPMVPDAPNLLPRPQHVVLNHTYCD
GTKSESGVQVLGTTHRYRSKYITVVFLKATQS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggagggcgcggatgcgctttcgtacgggtgcgcgcgcgatcgcgacggcgaacgagg
gagggaaacgcgcgcggggcgcgcggggaagagagtcccgagcgcgagggcgcggcgcgg
cgacgcgcggcgacgaggacacgactgacgaacgcgcgcgcgaacagaccgcaaacgccc
acggtgccgatacccggcggggagggtggaggggtgaattacccggcgtgggcgacgacg
gaaccggcgctggtgccggtggcgataaattggacccaaggcgggaacagcgtggaggtg
gaggggagctttgataactggcagtctcggcagacgctgcatcggagcgggaacagggag
tttgcgatcgtgatgtcgctgcgaccgggggtgtatcagtacaagtttatagtggatgga
cagtggaaatacgcgccggatcaaccggcgatgtacgacgagattggcaacgtgaacaac
gtgttggaggtgcaggaatacgtgccagaaattttggatagcttggatgcgtttacggcg
ccggcgtcgccaccggcgagctacgattgcgcaccgtttaactcggacgactttgcaaag
gaaccgccaccgctaccaccgcagttgcacatgactctgttgaacatgcccatggtgccc
gacgcgccgaatttgctcccgcgaccgcaacacgtggtgctcaatcacacgtattgcgac
gggacaaagtcggagagcggagtgcaggtgctcggaacgacgcacagatatcgatcaaag
tacatcacggtcgtcttcttgaaagccacgcaatcgtag

DBGET integrated database retrieval system