KEGG   Ostreococcus lucimarinus: OSTLU_34998Help
Entry
OSTLU_34998       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K05609  ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     OSTLU_34998
Peptidases [BR:olu01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   OSTLU_34998
Ubiquitin system [BR:olu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    OSTLU_34998
  UBL-specific proteases (ULPs)
   OSTLU_34998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C12
Motif
Other DBs
NCBI-GeneID: 5003510
NCBI-ProteinID: XP_001419640
JGI: 34998
UniProt: A4S327
Position
9:585940..586617
Genome map
AA seq 225 aa AA seqDB search
MPKRWLPLEANPEVMNAFARHLGLSDDFAFHDIYGFDDELLDFVPQPCVAVLLLFPITPA
TEAIEGEPKPETSSSGEPWFARQTVGNACGTMGVLHAALNGAGATKPGSYFEQLRARCEG
LDADARAKIIESDDALETAHVGASVEGQSEVPREDAEVDLHFVALVEANGGIWELDGRKP
TGPAYHGPSSDKGLLRDCVPVIKKFMNAANGSIHFNAIALAANLG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaacgttggcttccgctcgaagccaacccagaggtgatgaacgcattcgcccgt
cacctcggtctgagcgacgacttcgcgtttcacgacatctacggctttgacgacgaactg
ttggactttgtaccgcagccgtgcgtcgccgtgttgctcctgttccccatcacccccgcc
acggaagcgatcgagggcgagccgaagcccgagacgagctcgagcggcgagccgtggttc
gcgagacagacggtggggaacgcgtgcgggacgatgggggtgctgcacgccgcgctgaac
ggcgcgggcgcgacgaagccggggagttactttgagcagctgcgagctcgctgtgagggt
ttggacgcagacgcgcgggcgaagatcatcgaaagtgacgacgctttagaaaccgcgcac
gtgggggcgtccgtggagggtcagtcggaggtgccgcgcgaagacgccgaggtggatttg
cactttgtcgcgctcgtcgaggcgaacggaggaatatgggagctcgatggacgcaaaccg
accggacccgcgtaccacggaccgagctcggataaaggtttgttgcgcgactgcgtgccc
gtgatcaaaaagttcatgaacgccgcgaacggatcgatccatttcaacgccatcgcgctc
gcggcgaatctcggctag

DBGET integrated database retrieval system