KEGG   Ostreococcus lucimarinus: OSTLU_36966Help
Entry
OSTLU_36966       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00450  Selenocompound metabolism
olu00970  Aminoacyl-tRNA biosynthesis
olu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:olu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    OSTLU_36966
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    OSTLU_36966
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:olu01007]
    OSTLU_36966
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:olu03016]
    OSTLU_36966
Enzymes [BR:olu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     OSTLU_36966
Amino acid related enzymes [BR:olu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   OSTLU_36966
Transfer RNA biogenesis [BR:olu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    OSTLU_36966
 Prokaryotic type
   Other AARSs
    OSTLU_36966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 5001433
NCBI-ProteinID: XP_001417517
JGI: 36966
UniProt: A4RW36
Position
4:complement(<470372..472090)
Genome map
AA seq 573 aa AA seqDB search
MGGAPSAAKRGAAREDGDARSGGPTPAANEVEDARIALEAVDVRERAKEVDDDARAKERA
VEDAGRGVKDPRGERFSVTTAINYANGAPHMGHAYESISTDVLARYHRAYGRQVLFQTGS
DEHGQKIAEAAEEKGMAPLAFVDTHVAEFQNLNKRLDVSNDVYNRTTSEAHKKACAELFR
RSRDNGDIYLDTYEGWYNVREETFVTESEAQASGYKDPVSGKDLKKMKEESYFFKQSRYQ
KQLIAHIESNPEFIQPSSRRNEILARLQNDDLRDLSVSRTTFDWGIPVPDAPKHVMYVWF
DALTNYLTGTGWPEETENKDFWPASVHIIGKDIIWFHCVIWPCMLWSAGLPLPKTVFGHG
FVTADDGQKMSKSIGNVVDPNDVLKRFSSDTFRYYLMRCGVYGADVPFSEPAMIAIHNAD
LADVIGNLVHRVTNLCKKNCGGIIPDCASENVFSVGVLRAKSEAAMSRFNIQGACELAIE
AIKCTNKYLTDSAPWAVKGEGAEERKSVIIKSTLEAVYVAMHFLQPYVPKACGLVFEKLG
VPAVKIWELKPFGENVPIGATVAIGDVLFAKFE
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcgcgccgtcggcggcgaagcgcggcgccgcgcgcgaggacggcgacgcgagg
agcggcggacctacgccggcggcgaacgaggtcgaggacgcgcggatcgcgctcgaggcc
gtcgacgtgcgcgagcgcgcgaaagaggtggacgatgacgcgcgcgcgaaagagcgcgcg
gtcgaggacgcgggacgaggggtgaaggacccgcgaggggagcgatttagcgtgacgacg
gcgatcaactacgcgaacggggcgccgcacatgggacacgcgtacgaatccatctccacc
gacgtcctggcgagataccatcgagcgtacggacggcaggtgttgtttcaaacgggctcg
gacgaacacgggcagaagatagcggaggcggcggaggagaaggggatggcgccgttggcg
ttcgtggacacgcacgtggccgagttccaaaacttgaacaaacgattggacgtgtcgaac
gatgtgtacaatcgcacgacgagcgaagcgcacaagaaagcgtgtgcagagctgttcaga
cgctcgagagataacggggacatttatttggacacgtacgaggggtggtacaacgtgcgc
gaggaaacctttgtgacggagagcgaagcgcaggcgagcgggtacaaagacccagtcagt
gggaaagacttgaaaaagatgaaggaagaaagttactttttcaaacaaagccgatatcaa
aaacagctcatcgcgcacattgagtcgaatccggagtttattcagccctcgtctcgacga
aacgagattttggcgcgcttgcaaaacgacgatcttcgagatttgtctgtatcgcgcacg
acgttcgattggggtattccagtgcccgatgccccaaagcacgtcatgtacgtgtggttc
gacgcgcttacaaactatctcaccggtacggggtggcctgaggagactgaaaacaaagat
ttttggcccgcaagcgtgcacatcatcggtaaagacatcatctggtttcactgcgtcatc
tggccgtgcatgctgtggagcgccggattgccgcttccgaagacggttttcggtcacggt
ttcgtgaccgcggatgacggacaaaagatgagcaagtcgatcgggaacgtcgtcgatccg
aacgacgttttgaagaggttttcgagtgatacgttccgctactacttgatgcgctgcggc
gtttacggcgcggacgtgcctttcagtgaacctgcgatgatcgcgattcacaatgctgat
ttagccgacgtcatcggaaacttagtgcaccgagtcacgaacctttgcaagaagaattgc
ggaggaatcatcccggattgcgcctcggagaatgtgtttagcgtcggcgtgttgcgagcg
aaatctgaagccgcaatgtctagattcaacattcaaggcgcgtgtgaactcgccattgaa
gccatcaagtgtacgaacaagtacctcacggactccgcgccgtgggcagtcaagggcgaa
ggcgcggaagagcgcaagagcgtcatcatcaagagcactctcgaggcagtgtacgtggcg
atgcactttttgcagccttacgttccaaaggcatgcggcttggtgtttgaaaagctcggt
gttccggccgtgaaaatttgggaactcaagccgttcggtgaaaacgttcccatcggggcg
acggtcgccatcggtgacgttttgtttgccaaatttgaa

DBGET integrated database retrieval system