KEGG   Ostreococcus lucimarinus: OSTLU_39898
Entry
OSTLU_39898       CDS       T01029                                 
Name
(RefSeq) predicted protein
  KO
K03033  26S proteasome regulatory subunit N3
Organism
olu  Ostreococcus lucimarinus
Pathway
olu03050  Proteasome
Brite
KEGG Orthology (KO) [BR:olu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    OSTLU_39898
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:olu03051]
    OSTLU_39898
Proteasome [BR:olu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     OSTLU_39898
SSDB
Motif
Pfam: PCI Rpn3_C CSN8_PSD8_EIF3K TPR_2
Other DBs
NCBI-GeneID: 5000052
NCBI-ProteinID: XP_001415380
JGI: 39898
UniProt: A4RQF9
Position
1:68838..70175
AA seq 445 aa
MVRRELTSENVRAFVGAVLPEESAARAALLARCETKAAGRQTRGKSAGTKGKGGESDDAV
VDLSDVAPCALPEAEVYAYLVVLMHLIDGERGEDALECAREAVDRIKQFNRRSMDVLAAR
VYFYYSLAYERFGSLEDARATLLALYRTSALRLDEIGQETLVNLLLRNYLHYNLYDHAEK
LRSRVTLPQSRSIQQQCRYAYYLGRIRAVQLEYSEAKEYLTQAYQKAPTGAKGFRLELLK
WITIVRMLLGEIPERKELTQPEMRAALAPYFDLVQAVRMGDLTAFQRAAETHGTTFTEDK
LSNLINRLRANVIRTGLTRINTAYSKISLADVAEKLGLPSVEDAESVVAKAIRDGNVDAV
IDHSAKVMYSKETTDVYSTQEPQSAFHVRIAFCLDTHNEAVKAMRYPPKEKAKTADALAS
RGVDNDASGLDLADFDDDYDDMDFF
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggtgcgacgagagctcacgagcgagaacgtgcgcgcgttcgtgggcgcggttttgccg
gaggagagcgcggcgcgagcggcgctcttggctcgatgcgagaccaaagcggcgggaaga
cagacgagagggaagagcgcggggacgaagggcaagggcggcgaaagcgatgatgcggtg
gtagacttaagcgacgttgcgccgtgtgcgcttccagaggcggaggtgtacgcgtacttg
gtagttttgatgcacttgattgacggcgagcgaggcgaggacgcgctcgagtgcgcgcga
gaggcggtcgatagaatcaagcagtttaaccgtcgatcgatggatgtgctcgcggcgaga
gtgtacttttactactcactcgcgtacgagagatttggatcgctcgaagacgcgcgcgcg
acgcttctggcgctgtatcggacgtcggcgctgcgcctggacgaaatcggccaagaaact
ttggtcaacttgctgttgcgcaactacttgcactacaacctttacgaccacgcggaaaag
cttcgatcgagggtgacgctgccgcaatcgcgatcgattcaacagcagtgccgttacgcg
tactacctcggtcgcattcgcgccgtgcagttggaatacagcgaggcgaaggagtacctg
acgcaggcgtaccaaaaagcgccgacgggggcgaaggggttccgtctcgagctgttgaag
tggatcaccatcgttcgaatgcttttgggagagattcccgagcgaaaggagctgactcag
ccggagatgcgcgcggccttggcaccgtatttcgatctcgtccaggcggtgcgcatgggc
gacttgaccgcgtttcaacgcgcggcggagacgcacgggacgacgtttaccgaagacaag
ttgtccaacttgatcaaccgcttgcgcgcgaatgtcattcgaaccgggctcacgcgtatt
aacactgcgtactccaagatttccctcgccgacgtggccgagaagctcggtttgccgagc
gtggaggacgcggaatccgtcgtcgcgaaggcgattcgcgacggcaacgtcgacgccgtc
atcgatcattcggccaaggtgatgtatagtaaggagaccacagacgtctacagcacgcaa
gaaccgcaaagtgcgttccacgtgcgcatcgcgttttgcttggacacgcacaacgaagcc
gtcaaggcgatgcgttacccgcccaaggagaaggcgaaaaccgccgacgcgctcgcgtcg
cgcggcgtcgacaacgacgcctcaggattagatctcgcggatttcgacgacgactacgac
gatatggacttcttctag

DBGET integrated database retrieval system