KEGG   Ostreococcus lucimarinus: OSTLU_43800Help
Entry
OSTLU_43800       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K06443  lycopene beta-cyclase [EC:5.5.1.19]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00906  Carotenoid biosynthesis
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    OSTLU_43800
Enzymes [BR:olu01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.19  lycopene beta-cyclase
     OSTLU_43800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lycopene_cycl Pyr_redox_2 Thi4 FAD_oxidored FAD_binding_2 DAO Trp_halogenase HI0933_like GIDA NAD_binding_9 NAD_binding_8 FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 5006547
NCBI-ProteinID: XP_001422489
JGI: 43800
UniProt: A4SAS8
Position
20:116907..>118490
Genome map
AA seq 528 aa AA seqDB search
MRARRAPAARVTRAIRARGDAGTRARDVAPGATRRGASATPRATRRPSARETRPELYGLD
ASWDPLTSGDRRESEESRTPLPETLPNVRWGTSASEAYDLVIVGCGPAGLTAADEASKRG
LRVALMDPSPLAPWMNNYGVWCDEFKSLGFDDCYRAVWNKARVIIDDGDADGKMLDRAYA
QVDRKKLKQKLIARSVTQGVEFGIAAVDSCDNSDPNHSVVTLSDGRKVYAKMVLDATGHS
RKLVDFDRDFTPGYQAAFGIVCTVEKHDFPLDTMLFMDWRDEHLSPEFKRANDRLPTFLY
AMPFSETEVFLEETSLVARPGLEFDDLKLKLKERLDYLGVKVTKVHEEEYCLIPMGGVLP
TFPQRTLGIGGTAGMVHPSTGFMVAKTMLCVRTLVGTLDEALKAGKRGDITGALEAAEAA
QMNNGKFDADATAALVWNSIWPENDLRMRTFMCFGMETLMQLDIDGTRQFFDTFFDLPKD
VWAGFLSWRIQPVGLLSLGVNLFALFSNYMRVNFVKSALPFMGSFFAN
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgcgtcgagcgcccgcggcgcgcgtgacgcgcgcgattcgcgcgcgaggcgac
gcgggaacgcgcgcgcgcgacgtcgcgccgggcgcgacgcggcgcggggcgtcggcgacg
ccgcgggcgacgcgacggccgagcgcgagggagacgcggccggagctgtacggcttggac
gcctcgtgggacccgctgacgagcggcgatcggcgggagagcgaggagtcgcgaacgccg
cttccagaaacgctgccgaacgtgcgatgggggacgagcgcgagcgaggcgtacgatttg
gtgattgtcgggtgcggaccggcggggctgacggcggcggacgaggcgagcaagcgcgga
ttgcgcgtggcgttgatggatccgtcgccgctcgcgccgtggatgaataattacggggtg
tggtgcgacgagtttaaatcgctcgggttcgatgattgctatcgcgcggtgtggaacaag
gcgcgagttattatagacgacggcgacgccgacgggaagatgctcgaccgcgcgtacgcg
caggtggatcggaagaagctcaagcagaagctcatcgcgcgcagcgtgacgcagggcgtg
gagtttggtatcgccgcggtcgatagctgcgataacagcgatccgaaccattcggtggtg
actttgagcgatggacgcaaggtctatgcgaagatggttttggacgccactgggcactct
cgtaagctggtggactttgatcgcgattttacgccgggatatcaagccgctttcggaatc
gtgtgcacagtggagaagcacgactttccgttggacacgatgctgttcatggactggcga
gacgagcacttgagcccagagtttaagcgagcgaacgacaggttgccgacgtttttgtac
gccatgcctttctcggaaactgaggtgttcctcgaggaaacgagcttggtggcacgacct
ggcttagagtttgacgacttgaagctcaagttgaaggagcgtttggattatttgggcgtg
aaagtaaccaaggtacacgaagaggagtattgtctcattcccatgggcggcgtgttgccg
acgtttccgcaacgcacgctcggcatcggtggaaccgccggcatggtccatcctagcact
ggatttatggtcgcaaagacgatgttatgcgttagaacgctcgtaggcacgcttgatgaa
gcccttaaggcgggtaagcgaggggatattaccggcgccctggaagcggcggaggcggcg
caaatgaacaacggtaaattcgacgccgacgccaccgcggcattagtgtggaactcaatt
tggccggagaatgatttgcgcatgcgcactttcatgtgctttggaatggagactcttatg
cagctcgatatcgatggaacgcgtcaattctttgacacgttcttcgaccttcccaaggac
gtctgggctggctttttgagctggcgaatccagccggtgggcttgctttcgctcggggtg
aatctgttcgcgttgttttcgaactacatgcgagttaactttgtcaaatccgctctgcct
ttcatggggtcgttcttcgcaaac

DBGET integrated database retrieval system