KEGG   Ostreococcus lucimarinus: OSTLU_44779Help
Entry
OSTLU_44779       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00500  Starch and sucrose metabolism
olu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OSTLU_44779
Enzymes [BR:olu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     OSTLU_44779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-GeneID: 5000224
NCBI-ProteinID: XP_001416117
JGI: 44779
UniProt: A4RT90
Position
2:275893..277575
Genome map
AA seq 560 aa AA seqDB search
MGPVGQPVPNGYGDYYPTPRDDRRAGVIMHPTSLPGAYGIGDAGPEARAFVDWMAKGKMS
IWQVLPLVPPGRPIPGVREDYWSPYSGRDAHCGNTLVISLDDLVADGLLETKDLPKAYGG
SENVDFGRVAATNEPLIAKAAEKLLAMASGSGLKGEYDAFCARADVKAWLDPAATFDAID
STPELLGKYWWDWPAEYRDRDPGALAAIESEKASSIELFKATQFLFHVQWMRLKKYANDR
GVSLVGDMPIYVGGHSADVWANQNLFLLGDDKRPSALAGVPPDAFSEDGQLWGNPLFDWG
EHARTDYAWWAQRLKRTLELHDEVRIDHFRAFAAYWEVEAGAPTAKSGRWMVGPGVDMFN
KLKPALGDAKIVAEDLGVITADVVDLRQECGFPGMVVLQFAWGGNGRNPHLLHNHYENSF
CYPGTHDNETSQGWYAQQDEDTKRRLEAYAGIAYGDGAWGMIKAGMSSVSKACVFTMQDV
LALGNEARMNTPGVADGNWSWRIGEPGVFATLDAEAHKLASLATVYDRVADPDAQSMRES
CQSVAGGGRGGLFGLGFWIF
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgggtccggtgggacaacctgtcccgaatggatacggcgattattaccccaccccgcgc
gacgatcgccgcgcgggcgtgatcatgcaccccacgagtctgcccggagcgtacgggatc
ggcgacgcgggcccggaggcgcgcgcgttcgtggattggatggcgaaaggaaagatgagt
atctggcaggtgctgccgctcgtgccgccgggacgtccgataccgggcgtgcgggaagac
tattggtcgccctacagcggacgcgacgcgcactgtggaaatacgctcgtgatatcgctg
gatgatttggtcgcggacgggctgctcgagacgaaagatttgccgaaggcgtacggcgga
agcgaaaacgtggatttcggacgcgtcgcggcgacgaatgagccgctgattgcaaaggcg
gcggaaaagttgctcgcgatggcgagtggtagtggactaaagggggagtatgatgcgttc
tgcgcgcgcgcggatgtgaaggcgtggttagatcccgccgcgacgttcgacgccatcgat
tcgacgccggaactcttgggtaaatattggtgggattggcccgcggaatatcgcgatcgc
gatccaggcgcgctcgcggcgatcgaaagcgaaaaagcgagttcgattgaactcttcaag
gcgacgcaatttctgttccatgtgcagtggatgcgtttgaaaaagtacgccaacgataga
ggcgtttctctggtgggcgacatgcctatctacgtcggcggtcacagcgccgacgtgtgg
gcgaatcaaaacttattcttgctcggtgacgataaacgcccgtcggcgttggcgggtgta
ccacccgacgcgttctccgaggacggtcagttgtggggtaacccgttgtttgattggggc
gagcacgcgcgaacggattacgcgtggtgggctcagcgattgaagcgcacgctcgaactt
cacgacgaggtgcgcatcgatcacttccgcgcctttgcggcgtactgggaagtcgaagcc
ggcgcgccgacggcgaagagcggtcgatggatggtcggtccgggggtggatatgttcaac
aagctcaagccggcgctcggcgacgcgaaaatcgtcgcggaagatctcggggtcatcacc
gccgacgtcgtcgatttgcgtcaagagtgcggtttcccgggtatggttgtccttcagttc
gcgtggggtggtaacgggcgcaacccgcacttgctgcacaaccactacgaaaattcattt
tgctacccgggcacgcacgacaacgaaacgtcgcaaggctggtacgcgcaacaggacgag
gacaccaagcgccgcttggaggcgtacgccggcatcgcctacggcgacggcgcgtggggc
atgatcaaggctgggatgtccagcgtgagcaaggcgtgcgtattcaccatgcaagacgtc
ctcgccctcggcaacgaggcgcgcatgaacacccccggcgtcgccgacggcaactggtcc
tggcgcatcggtgaaccgggcgttttcgccaccctcgacgccgaggcgcacaagctcgcg
agtttagccaccgtctacgatcgcgtcgccgacccggacgcgcagtccatgcgcgaatcc
tgtcaatccgtcgccggcggcggtcgaggcggcttattcggtttaggcttctggatcttc
tag

DBGET integrated database retrieval system