KEGG   Ostreococcus lucimarinus: OSTLU_45076Help
Entry
OSTLU_45076       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00500  Starch and sucrose metabolism
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OSTLU_45076
Enzymes [BR:olu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     OSTLU_45076
Exosome [BR:olu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OSTLU_45076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase CBM_48 Imm42
Motif
Other DBs
NCBI-GeneID: 5000814
NCBI-ProteinID: XP_001416858
JGI: 45076
UniProt: A4RTX0
Position
3:complement(152780..154912)
Genome map
AA seq 710 aa AA seqDB search
MPPIEGDGFAVCALDSMLEHHKGHLGHRFEKFKNLRQAIEDHEGGIEKFSRGYEKMGFTR
TAEGITYREWAPNASAACLRGDFNGWDLGENGKWMTKNDYGVFEVFLPNNADGSPAIPHG
SRVKIHLQIPNGEPVDRIPAWIKYAVQAQGEIPFNGIYYDPPEEEQYKFKYERPDAPEEL
RIYEAHVGMSSTEPKINSYVEFADDVLPRIKDLGYNAVQLMAVQEHAYYASFGYHVTNFF
GVSSRCGTPDELKYLVDKAHSMGLTVLMDLVHSHASSNSIDGINMFDGSNGQYFHSGPEG
YHWMWDSRCFNYGEWEVVRYLLSNLRYWIEEFKFDGFRFDGVTSMMYKHHGLQVAFTGNY
EEYFGMATDVDAMVYLMLANDMLHTLYEGKMTTIAEDVSGMPTLCRPVSEGGVGFDYRLQ
MAIADKWIEVLSEWGSDENWDMGNLVFTMENRRYGEKCISYAESHDQALVGDKTTAFWLM
DAEMYTNMSTLVPDSPVVSRGIALHKMIRQFTMGLGGEGYLNFMGNEFGHPEWIDFPRDD
RVEASTGEFIPGNGNSYHLCRRRFDLADMDHLRYKYLNAFDAQMNKVAGAFKYLASSHQY
TSCKSDADKVVVFERGDLVFVFNWNPTQSFSDYRIGCKEKTNYKLVLSSDNPEFGGYSNL
WTYTAPEFVAEDYAFNGRPASFLAYLPSRTVAVYAPADLADKVLGFAAPA
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgattgagggcgatggtttcgccgtctgcgcgctcgactcgatgttggaacac
cacaagggacacctcggtcatcgtttcgaaaagttcaagaacttgcgccaagcgatcgaa
gatcacgaaggtggcatcgaaaagttcagccgaggctatgaaaagatgggtttcacgcgc
accgcggagggcattacttacagagagtgggcgccgaacgcgtcggccgcgtgccttcgc
ggcgacttcaacggttgggatctcggcgagaatggcaagtggatgaccaagaacgattac
ggcgtgttcgaagtgttccttccgaacaacgcggacggttctccggccatcccgcacggc
tctcgcgtgaagattcatcttcaaattcccaacggcgaacccgtcgaccgcatcccggct
tggatcaagtacgcggtgcaggcgcaaggcgaaattccgttcaacggcatctactacgat
cccccggaagaagagcagtacaagttcaagtacgagcgaccggatgcccccgaagagctt
cgcatttacgaagcgcacgtcgggatgtcttccaccgagccgaagatcaactcttacgtc
gagttcgccgacgatgtcttgccgcgcatcaaagacctcggttacaacgccgtacaattg
atggctgttcaagagcacgcgtactacgcatctttcggctaccacgtcaccaatttcttc
ggcgtgtcttctcgatgcggtacgcccgatgaattgaagtacttggtcgacaaggcgcac
tccatgggcctcaccgtgctcatggatttggtgcactctcacgcgtcgtccaactccatc
gacggcatcaacatgttcgacggtagcaacggtcagtacttccactctggtccggaaggt
tatcattggatgtgggattcccgatgcttcaactacggcgaatgggaagtcgtgcgctac
ttgctctcgaaccttcgctactggatcgaagaattcaagtttgatggtttccgtttcgat
ggcgtgacgtccatgatgtacaagcatcacggtcttcaagtcgccttcacgggtaactat
gaagagtactttggcatggccactgacgtcgacgccatggtgtacctcatgctcgccaac
gacatgcttcacactctctacgaaggcaagatgacgacgatcgcggaagacgtgagcggc
atgccgacgctttgccgcccggtcagcgaaggcggtgtcggtttcgactatcgcctccaa
atggccatcgcggacaagtggatcgaggtcttgagcgagtggggttcggatgaaaactgg
gacatgggtaacttggtgttcaccatggagaaccgtcgctacggcgaaaagtgcatctct
tacgccgaatctcacgatcaagcgctcgttggcgataagactaccgctttctggttgatg
gatgcagaaatgtacaccaacatgtccacgctggtacccgacagccccgtcgtgtcgcgc
ggcattgccttgcacaagatgattcgccaattcacgatgggtctcggtggcgaaggttac
ttgaactttatgggtaacgaattcggccacccggagtggatcgatttcccgcgcgatgat
cgcgtcgaggcgtcgacgggtgaattcatcccgggtaacggcaactcgtaccatttgtgc
cgccgacgattcgacttggccgacatggaccacttgcgctacaagtacctcaacgcgttc
gacgcgcagatgaacaaggtcgccggcgctttcaagtacctcgcgtctagccaccagtac
acgtcgtgcaagagcgacgcggataaagttgtcgtgttcgagcgcggtgacttggtgttt
gtgttcaactggaacccgacgcagtcgtttagcgactaccgcatcggatgcaaggaaaag
acgaattacaagctcgtgctgagctcggacaaccccgaatttggtggttactccaacttg
tggacgtacacggcgcccgaatttgtcgccgaagattacgccttcaacggtcgcccggcc
tcgttcttggcgtacttgccctcgcgcaccgtcgccgtgtacgctccggccgacttggcg
gacaaggttctcggcttcgcggctccggcttaa

DBGET integrated database retrieval system