KEGG   Ostreococcus lucimarinus: OSTLU_45513Help
Entry
OSTLU_45513       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K00855  phosphoribulokinase [EC:2.7.1.19]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00710  Carbon fixation in photosynthetic organisms
olu01100  Metabolic pathways
olu01200  Carbon metabolism
Module
olu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
olu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:olu00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OSTLU_45513
Enzymes [BR:olu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.19  phosphoribulokinase
     OSTLU_45513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRK AAA_16 AAA_22
Motif
Other DBs
NCBI-GeneID: 5001165
NCBI-ProteinID: XP_001417260
JGI: 45513
UniProt: A4RW43
Position
4:join(480251..480605,480743..481533)
Genome map
AA seq 381 aa AA seqDB search
MASALGFATAVRARPVAAQKRATAPKARSARVVTQAKRDGPVIIGLAADSGCGKSTFMRR
MTSLFGGKATPPEGGNPDSNTLISDTTTVLCLDDYHLNDRQGRKDSGLTALNLKEQNFDL
MYEQVKALKEGKSVDKPIYNHVTGVFDPAEKIESPEVLILEGLHPFADTRVRDMFDFKIY
LDISDEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAFVDPQKEFSDVIIQVLPTQL
IPDDNEGKILRVRMIMKEGLENFDAPFLFDEGSTISWIPCGRKLTCSYPGIKFFYGPDTF
YGKEVTVLEMDGQFDKLEELIYVESHLSNTSTKFYGEITQQMLKYQNGPGSNNGTGFFQT
IVGLKVREVYERIAEKEVVVK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgcgctcggattcgcgaccgcggtgcgcgcgcgccccgtcgccgcgcaaaag
cgcgcgacggcgccgaaggcgcgcagcgcgcgcgtcgtcacgcaggcgaaacgcgatggt
ccggttatcatcggtttggccgcggactccggatgcggcaagtcgacgttcatgcgacgc
atgacgtcgctgttcggcggcaaggcgacgccgcccgagggtgggaacccggactcgaac
acgctgatttcggacacgacgacggtgctttgcttggatgattaccacttgaacgacagg
caaggacgcaaggatagcggtttgacggcgttgaacctcaaggagcaaaactttgacttg
atgtacgaacaagttaaggcgctcaaggaaggcaagtccgtggataagccgatctacaac
cacgtcaccggtgtcttcgacccggcggagaagatcgagtccccggaggttctcatcctc
gaaggtcttcacccgttcgcggacacccgcgtgcgcgacatgttcgacttcaagatctac
ttggacatctccgacgaagtgaagttcgcgtggaagatccaacgcgacatggcggagcgt
ggtcactcccttgagtccatcaaggcgtccatcgaagcgcgcaagccggatttcgacgcc
ttcgtcgacccgcaaaaggagttctccgatgtcatcatccaagtgctcccgacccagctc
atcccggatgacaacgagggtaagatcttgcgcgtgcgcatgatcatgaaggaaggcctc
gaaaacttcgacgctccgttcttgttcgacgaaggttccaccatctcttggatcccgtgc
ggccgtaagttgacgtgctcctacccgggcatcaagttcttctacggtccggacaccttc
tacggcaaggaagtcaccgtgctcgaaatggacggtcaattcgacaagctcgaagagctc
atctacgtcgaatcccacttgtcgaacacctccacgaagttctacggcgagatcacgcaa
caaatgctcaagtaccaaaacggcccgggctccaacaacggtaccggtttcttccagacc
atcgttggcctcaaggtgcgtgaagtgtacgagcgcatcgcggagaaggaggttgtcgtt
aagtaa

DBGET integrated database retrieval system