KEGG   Ostreococcus lucimarinus: OSTLU_47741
Entry
OSTLU_47741       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K03845  alpha-1,3-mannosyltransferase [EC:2.4.1.258]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00510  N-Glycan biosynthesis
olu00513  Various types of N-glycan biosynthesis
olu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:olu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    OSTLU_47741
   00513 Various types of N-glycan biosynthesis
    OSTLU_47741
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:olu01003]
    OSTLU_47741
Enzymes [BR:olu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.258  dolichyl-P-Man:Man5GlcNAc2-PP-dolichol alpha-1,3-mannosyltransferase
     OSTLU_47741
Glycosyltransferases [BR:olu01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   OSTLU_47741
SSDB
Motif
Pfam: ALG3
Other DBs
NCBI-GeneID: 5005896
NCBI-ProteinID: XP_001421867
JGI: 47741
UniProt: A4S939
Position
16:182969..184237
AA seq 422 aa
MSIRAVLASLNDPRDRRCVRIVCVALIAFELALCAVIIAKVAYTEIDWIAYMEEVHGYAR
GERDYTKLKGGTGPLVYPAGFVYAYKALYDLVGGLERGTSARGVATAQVVFALVYAAHQA
LVFSMYAMCEIIPPWAYALLCLSKRVHSIFVLRMFNDGVAMALAYGATTLFQRKRWIAGS
VVFSLGVSVKMNVLLMLPGLLVLLVGGTSAGTAIGAVAAIVGTQIALGAPFLATYPREYL
SRAFELGRVFTHKWSVNFKFVSEDIFVSKSFAKYLLLAHLVCLFVFAHRRWCAREGGFFF
NFVRDFFKRLLLRNVDGVQSTFTPAHVALVLAQSNLIGIVFARSLHYQFYSWYFHTIPLL
LWSNPRVPVGAKLAIMGAIEWCWNVYPSTPTSSKIFVVIHLGVLAVAYAAPTASRRGKQK
SA
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgtcaatccgcgccgtgctcgcgtcactcaacgatccgcgcgatcgtcgatgcgtgcgc
atcgtctgcgtcgcgttaatcgcgttcgaactcgcgttgtgcgcggtaatcatcgccaaa
gttgcctacacagaaatcgattggatcgcgtacatggaggaagtgcacggctatgcgcga
ggcgagcgcgattacaccaaactgaaaggtggcactggacctttggtatacccagctggg
ttcgtgtacgcgtacaaggcgctgtatgatttggtgggtgggcttgaacgcgggacgagc
gcgcgcggcgtggcgacggcgcaagtcgtcttcgcgttagtgtacgccgcgcatcaagcg
ctggtgttctcgatgtacgcgatgtgtgaaattataccaccgtgggcgtacgcattgttg
tgcctgtcgaagcgcgtacacagtatttttgtgcttagaatgttcaacgacggcgtcgcg
atggcgttggcgtatggcgcgacgacgttgtttcaacgcaaaaggtggatcgcggggagc
gtggtgttttctctcggagtgtcggtgaagatgaacgtattattgatgcttcctgggtta
ttggtactgctggtaggaggtacgagcgcgggaacggccatcggagctgtcgcggcgatt
gtggggacgcaaatcgcgctcggcgcgccgtttcttgcgacgtatcctcgcgagtatcta
agccgcgcgttcgagctcggtcgcgtgttcacgcacaagtggagcgtcaacttcaagttt
gtgtcggaagacatttttgtgtcgaagtcattcgcaaaatacctacttcttgcgcacttg
gtctgcttgtttgtcttcgcgcaccgacggtggtgcgcacgcgaagggggatttttcttc
aatttcgtgcgagatttcttcaaacgcttgctcctgaggaacgttgatggcgtgcaatcg
acgtttacccccgcgcacgtcgcgctggtgctggcgcagagtaacttgatcggcatcgtt
tttgcgcgttcgttgcattatcaattttattcgtggtactttcacactatacccctgttg
ctttggtccaacccacgagtgccggtgggggctaagctcgcaatcatgggtgcgatagag
tggtgttggaacgtctacccgtccacgccgacgtcgagtaagattttcgtcgtcattcac
ctcggtgttctggcagttgcttacgccgcgccgacggcgtcgagacgtggcaaacaaaag
agcgcgtag

DBGET integrated database retrieval system