KEGG   Ostreococcus lucimarinus: OSTLU_49215
Entry
OSTLU_49215       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00100  Steroid biosynthesis
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:olu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    OSTLU_49215
Enzymes [BR:olu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     OSTLU_49215
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 5000714
NCBI-ProteinID: XP_001417012
JGI: 49215
UniProt: A4RUS9
Position
3:complement(656273..657658)
AA seq 461 aa
MPASARRAPSTRARGSSRGVAERATTTRAASSEKARARDAPTTTHYEFGGPIGALAITVA
LPLVCYFLAYACNEDGCAEVSKLARGGAFPGFPKHMPLWSVDGAVAAYGWMAFTVVAHAV
IPGQKKQGVALPDGTRLTYKLNGFRVLAATAVAGAIGTKAGWFDLASVHDNFLSMLTAMV
VLAYALSAYLYASSFAKGKTLAKGGNSGNAAYDFFIGRELNPRILNGAFDLKVFCELTPG
LIGWLLLDLGFAAKQYARVGAVSAPMIMVCVFQGAYVIDALWNEPAILTTMDITTDGFGF
MLAFGDLVWVPFTYSLQCRYILEHAVELSNAHLVAIFAVQCVGYWVFRGANSQKNLFRTN
PNDPRVKHLKTLQTKRGTKLIVSGWWGVCRHVNYLGDWIMAWAWCLPCGFSHLVPYFYVI
YFGILLVHRDGRDGEACEEKYGDDWKKYCAIVKYRLIPYIY
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgcccgcgtccgcgcgtcgcgcgccctcgacgcgcgcgcgcgggtcgtcgcgcggcgtc
gccgaacgcgcgacgacgacgcgcgccgcgtcatccgaaaaggctcgcgcgcgcgacgcg
ccgacgacgacgcactacgagttcggcggaccgatcggcgcgctcgcgatcacggtcgcg
ctgccgctggtgtgctactttctcgcgtacgcgtgcaacgaggatgggtgcgcggaggtt
tcgaagctcgcgcgaggcggcgcgttcccggggttcccgaagcacatgccgctgtggagc
gtcgacggcgccgtcgccgcgtacggatggatggcgttcacggtcgtcgcgcacgcggtg
attccggggcagaagaaacagggcgtcgcgttgccggacggaacgcggctgacgtacaag
ctcaacgggtttcgcgtcttggcggccaccgcggtcgcgggcgcgatcggtaccaaggcg
ggttggttcgatttggcgtccgtgcacgataactttttgtcgatgctcacggccatggtg
gtgttggcgtacgcgctgtcggcgtatttgtacgcgagctcgtttgcgaaagggaagacg
ctcgcgaagggcggaaacagcggcaacgcggcgtacgactttttcatagggcgtgagctg
aatccgaggatcttgaacggagcgtttgacttgaaggttttctgtgaactcacgcccggt
ttgatcggatggttgctgttggatttaggtttcgccgcgaagcagtacgcgcgcgtcggc
gccgtctccgcgccgatgattatggtgtgcgtgtttcaaggggcgtacgtcatcgacgcg
ctgtggaacgaaccggcaatcttgaccacgatggacatcaccaccgacgggttcggtttc
atgctcgcttttggagatttggtgtgggtgccattcacgtactcgttgcagtgccggtac
attctcgaacacgccgtcgagctctccaacgctcacctcgtcgccatctttgccgtgcag
tgcgtcggctactgggtgtttcgcggcgcgaattctcaaaagaacctgtttcggaccaac
cccaacgaccctagagtgaagcatctgaagacgttgcaaaccaagcgaggcacgaagctc
atcgtcagcggttggtggggcgtctgccgccacgtcaattacctcggcgattggattatg
gcgtgggcgtggtgcttaccgtgtggtttctctcacctcgtcccttacttttacgtcata
tactttggcattctattggtacatagagacggtcgcgatggcgaagcgtgcgaggaaaaa
tacggagacgactggaaaaagtactgcgccatcgtcaagtatcgtctgatcccttacatt
tattaa

DBGET integrated database retrieval system