KEGG   Ostreococcus lucimarinus: OSTLU_8608Help
Entry
OSTLU_8608        CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K02890  large subunit ribosomal protein L22
Organism
olu  Ostreococcus lucimarinus
Pathway
olu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:olu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    OSTLU_8608
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:olu03011]
    OSTLU_8608
Ribosome [BR:olu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    OSTLU_8608
  Bacteria
    OSTLU_8608
  Archaea
    OSTLU_8608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 5001116
NCBI-ProteinID: XP_001417107
JGI: 8608
UniProt: A4RVA9
Position
3:complement(<964836..>965162)
Genome map
AA seq 109 aa AA seqDB search
ESASAILRGAKGSPKKFSAFLRLVRGLRVDDALIQCDMSPKRVAKTVAKVLQSAIGNAVN
NQGLDRERLVVSSATVGKGEYLRRVSIHGRGRAGVMHRPRSHVRVTVEE
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
gagagcgcgagtgcgattctacggggcgcaaaaggctcaccgaagaagtttagcgcgttt
ctccgcctcgtccgcgggcttcgcgtcgacgacgcgctcatccagtgcgacatgagtcca
aagcgagtggcgaagactgtagcgaaggtgctccagagcgccattggaaacgcggttaac
aatcaagggctcgatcgcgagcgactagtagtgtcgtccgcgacggtcggaaagggcgag
tacctgcgacgggtttccatccacggtcgaggacgcgcaggcgtcatgcatcgcccgcgc
tcgcacgtcagagtcaccgtcgaagaa

DBGET integrated database retrieval system