KEGG   Ostreococcus lucimarinus: OSTLU_92152Help
Entry
OSTLU_92152       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K17434  large subunit ribosomal protein L53
Organism
olu  Ostreococcus lucimarinus
Brite
KEGG Orthology (KO) [BR:olu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:olu03011]
    OSTLU_92152
Ribosome [BR:olu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    OSTLU_92152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MRP_L53
Motif
Other DBs
NCBI-GeneID: 4999484
NCBI-ProteinID: XP_001415879
JGI: 92152
UniProt: A4RRD0
Position
1:complement(617852..618193)
Genome map
AA seq 113 aa AA seqDB search
MPLRHLKRVRVQFNPLDPRSTAAREFLARVTTAKAAKSNPECAVEPRVRNDAAPPVVAVE
FASGARDQFNVHRMTVDDIARRIKTVSDQMAVKQSLAEAGLKLEDLRFDVRGT
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcccttgcgccacctgaagcgcgtgcgcgtgcaattcaacccgctcgatcctcgcagc
acggctgcgcgcgagttcctcgcccgcgtcaccacggcgaaggcggcgaaatccaacccc
gagtgcgccgtcgagccgcgcgtgcgcaacgacgccgcgccgccggtcgtcgcggtggag
ttcgcgagcggcgcgcgcgatcagtttaacgtccatcgcatgaccgtggacgatatcgcg
cgaaggatcaagacggtgagcgatcagatggcggtgaagcaatccctcgccgaggctggg
ttgaagcttgaagacttgaggtttgacgtgcgcgggacgtga

DBGET integrated database retrieval system