KEGG   Oleiphilus messinensis: OLMES_0168Help
Entry
OLMES_0168        CDS       T04860                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
ome  Oleiphilus messinensis
Pathway
ome00430  Taurine and hypotaurine metabolism
ome00620  Pyruvate metabolism
ome00640  Propanoate metabolism
ome00680  Methane metabolism
ome01100  Metabolic pathways
ome01120  Microbial metabolism in diverse environments
ome01200  Carbon metabolism
Module
ome_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:ome00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OLMES_0168
   00640 Propanoate metabolism
    OLMES_0168
  09102 Energy metabolism
   00680 Methane metabolism
    OLMES_0168
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    OLMES_0168
Enzymes [BR:ome01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     OLMES_0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase PTAC Molydop_binding
Motif
Other DBs
NCBI-ProteinID: ARU54276
UniProt: A0A1Y0I3A4
Position
complement(183869..185644)
Genome map
AA seq 591 aa AA seqDB search
MNILVVNCGSSSVKYQVVSTQTEAVLLEGLIERVGETCSYEEAFQQLLAQADHIELHAVG
HRVVHGGEAFKDAALISDDVIQSIEDCVKFAPLHNPANLAGIQATRAALPHLPQVAVFDT
AFHGQMPAKAAHYAIDRAIASKEGIRRYGFHGTSHGYVAQKAAEFLDRPLNELRLITLHL
GNGCSACAVEYGHSVDTSMGMTPLEGLMMGTRSGDIDPGAIMGLLRSGYSIDDVDNLLNK
NSGLKGVSGLSNDLREIEKAAVEGNEPARQAIDMFVYRARKYIGAYSAAMGGVDAIILTG
GIGENSVTMRQRILQRFDYMGLRFDEHKNGDAKVSHNKPAALVCRDISTVKALVVKTNEE
LMIAKQTTQIVNQQNSDNNPDSLQAKAIPIAVSARHVHLDKATFATLFGPNAELSHYKDL
SQPGQFASAEKVNLIGPRNRIDGVRVLGPLRGKNQVEVSRTDEFFLGIDAPVRDSGRTQG
SAPITLEGPNGTVDLVEGLICARRHIHMHTDDARRFGVEDGDEVEVAITGGPRDLVFGDV
LVRVSPAYRLEMHIDTDEGNAAELSRGVSGELVYTGIDFADAAILTKRAKG
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttagtcgttaactgtggctcttccagtgtgaagtaccaggtggtctctaca
cagacagaagcagtcctgctggaaggattgatcgaacgggtcggtgaaacctgcagctac
gaagaggctttccagcaattattggcacaagcagatcacattgagcttcatgccgtgggg
catcgtgtcgtgcacggtggagaagctttcaaggatgcagcactgatcagcgatgatgtt
atccaatccattgaagactgtgtcaaattcgcccccttgcataatcccgccaatctcgcc
ggaatacaagcaacccgggccgcccttccccatttaccccaagtggccgttttcgacact
gctttccacgggcaaatgcccgccaaagccgcgcactatgctattgatcgggctatcgcc
agcaaagagggtatccgccgatatggatttcacggtacatcccatggctatgttgcccaa
aaagcagccgagtttctcgaccgcccactcaacgaactccgcctgattacgctccatctg
ggcaacggctgcagtgcttgcgctgtggaatatggccactcggtggacaccagtatggga
atgacgccactcgaagggctgatgatggggacacgatccggggacatcgaccctggcgcg
attatgggcttgctgcgcagcggttattccatcgatgacgtcgataaccttctgaacaaa
aacagtggcctgaagggcgtctccggactcagtaacgaccttcgggaaatcgaaaaagcg
gcggtggaaggtaatgaacccgcccggcaggccattgatatgttcgtctatcgggcacgc
aaatacatcggggcctacagtgctgccatgggtggtgtggatgcgatcattctcaccggc
gggattggcgaaaacagtgtcaccatgcgccaacggattctacaacgctttgactacatg
ggcctgcgctttgatgagcataaaaacggcgatgccaaagtcagccacaataaacctgcc
gctctggtttgccgggatatttccactgttaaagccctcgtggtcaagaccaatgaagag
ctgatgatcgccaaacaaaccactcagattgtaaatcagcaaaacagcgataataatccg
gattccctgcaagccaaagcgataccgattgcggtcagcgcgcgtcacgttcatctcgac
aaagccacattcgcaacgttatttggtccgaatgcggaactaagtcactacaaagacctt
tctcagccaggccagtttgccagtgctgaaaaagtgaatttgattggcccgcgcaatcgg
attgacggggttcgggttctgggcccactgcgaggcaagaatcaggttgaagtgtctcgt
accgatgaatttttcctggggattgatgcgccggtgcgcgattccgggcgcactcagggt
tctgcaccgattacgctggaaggccccaatggtactgtggatctggtcgagggtttaatt
tgtgcccgtcgtcatatccatatgcataccgatgatgcacgccgttttggcgttgaagat
ggtgatgaagtcgaagtggcgattacgggtggcccacgggatctcgtttttggcgatgtg
ctggtacgtgtaagtccggcttaccggctggaaatgcacattgatacggatgaaggaaat
gcggcggaactgtctcgcggtgtcagcggagagctggtttataccgggattgattttgct
gatgccgccattttaaccaaacgggccaaaggatag

DBGET integrated database retrieval system