KEGG   Oleiphilus messinensis: OLMES_2033Help
Entry
OLMES_2033        CDS       T04860                                 

Definition
(GenBank) alpha/beta hydrolase fold domain protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
ome  Oleiphilus messinensis
Pathway
ome00903  Limonene and pinene degradation
ome00930  Caprolactam degradation
ome01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ome00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OLMES_2033
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    OLMES_2033
Enzymes [BR:ome01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     OLMES_2033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 COesterase Peptidase_S9 Thioesterase
Motif
Other DBs
NCBI-ProteinID: ARU56106
UniProt: A0A1Y0I8K6
Position
2279043..2279963
Genome map
AA seq 306 aa AA seqDB search
MVVKRDYDSVESLTRHLRRVFNHTPVPTILPYGVRLKHLSIGGLKGERVSVRDAENTVLY
IHGGGFVAGVTRTYHNLAGQLASQLNASVYLPSYRLAPEHPYPAGLEDIVSAYQWLLDKG
TNPSRLVVAGDSAGGGITLALLMKLRDMGLPLPKAAVTLSPAADARGVAESIEGNHATDA
LLSASLIHYAAEALLPGMDRMHPYASPALADFTGMPPLFITVDEEECLRDDAHLVARRAR
EAGCEVKLISRKGMFHVWPIFTPFLPEARRDIRRIVKFLQEQGLTVSNRPRIIEPKLVPF
MANSQG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggttgtaaagcgggattacgattccgttgagagtttaacccgtcacttgcgtcgggtc
tttaatcatacccctgtacccacaattctgccctacggtgtgcgtttgaagcacttatcc
attggcggcttgaaaggtgagcgcgtcagtgtgcgtgatgctgaaaacacagtgctgtac
atccacggtggtggttttgttgcgggggtcactcggacttaccataatctggctggacag
ctagcctctcaattgaatgcgtcagtctatttgccgtcttatcgcttggcccctgaacat
ccatatccggcagggcttgaagacattgtctcggcttatcaatggttattggataaaggg
actaatccctcacgcttggtggttgcaggtgactccgctggtggcggcattaccctggct
ttgctgatgaaattgcgcgatatgggtctaccgttaccgaaggccgcagtcaccttgtct
cctgcggcggatgcgcgtggtgtggcagagagtattgaaggcaatcatgcgaccgatgct
ctcttgtctgccagcctgattcattatgcggcggaggcgttgttgccggggatggatcgt
atgcatccttatgcgtctccggcactggccgatttcaccggaatgccgccactctttatc
acagtagatgaagaagaatgtctacgggatgatgcccatctggttgcgcgtcgtgcacgg
gaagcgggctgtgaagtgaaattgatctcacgcaaagggatgtttcatgtctggcctatt
tttacgccatttttgcctgaagcgcggcgtgatattcggcgcatagtgaagtttttgcaa
gagcaaggactaaccgttagtaaccggccacgaatcattgaaccgaagctggttccattc
atggcgaattctcaaggttaa

DBGET integrated database retrieval system