KEGG   Oleiphilus messinensis: OLMES_2853Help
Entry
OLMES_2853        CDS       T04860                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase family protein
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
ome  Oleiphilus messinensis
Pathway
ome00520  Amino sugar and nucleotide sugar metabolism
ome01100  Metabolic pathways
ome01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:ome00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    OLMES_2853
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    OLMES_2853
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ome01005]
    OLMES_2853
Enzymes [BR:ome01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     OLMES_2853
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     OLMES_2853
Lipopolysaccharide biosynthesis proteins [BR:ome01005]
 Unusual sugar
  OLMES_2853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_10 DapB_N NAD_binding_4 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ARU56901
UniProt: A0A1Y0I8W2
Position
complement(3245343..3246392)
Genome map
AA seq 349 aa AA seqDB search
MKILIIGVNGFIGSNLTQRILNTTNWEVYGMDINRSYIKNLEQSDRFHYTEGDIAINNEW
IEYHIKKCDVILPLVAIATPKKYVTDPLEVFELDFEQNLKIVRWAHQYKKRLIFPSTSEV
YGMSQDAEFNESKTNFVYGPIHKTRWIYACSKQLLDRIIYAYGRDYGLRYTCFRPFNWIG
PKLDNMGSARVGNSRVLTQFISNLIEGRAIQLVDGGEQKRCFTHVEDGLDCLMSILNNEE
LANGHIVNIGDPKNVSSVRDLAMLTRQIFAEQREISIEDIPEPEIVTEKEFYGNGFQDIT
HRLPCIDLARQLFSWEPRRRHEDGVRSAVAFFINHKGDDRVLSRNPTGM
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttgattattggtgttaacggttttattggttcaaacttaactcagaggata
ttgaatacaacaaactgggaagtttatggtatggatatcaatcgctcttacataaaaaat
cttgagcaaagtgatcgttttcactataccgaaggtgatattgctatcaataatgagtgg
attgaatatcacataaaaaaatgtgatgtaatccttccattggttgctattgcaacgcct
aaaaaatacgtaactgatcctttggaagtttttgaactcgattttgaacagaacttaaaa
attgtacgctgggctcatcaatacaaaaaaaggttgatttttccatcaaccagtgaggtt
tacggaatgagccaggacgctgagtttaatgaatcgaagactaattttgtttatggtcct
atacataagacaagatggatctacgcctgctccaagcagctgcttgatagaattatttat
gcatacggtcgagattatggtcttagatacacttgttttcgcccctttaactggattgga
cctaagttggataatatgggctcggcgcgtgtcggaaatagtcgagttctaacacaattt
attagcaatctgattgagggaagggcgatccagttagtggatggcggagagcaaaagcga
tgtttcactcatgtagaggacggtctcgactgcctaatgagcatacttaataatgaagag
ctcgcaaatggtcacattgttaatattggagatcccaagaatgtatcaagtgtacgggat
ctcgcaatgttaaccaggcaaatatttgcagaacagcgtgaaatttctattgaagatatc
cccgagccagagattgttactgagaaagagttttacggaaatggctttcaagatattacg
cacaggttgccttgcatcgatttggcgaggcagctatttagttgggagcctcgccgtaga
catgaagatggtgttcgttcagcagtagcgtttttcataaatcacaaaggtgatgatcgt
gtgctctcaaggaatcctacggggatgtag

DBGET integrated database retrieval system