KEGG   Oleiphilus messinensis: OLMES_2898Help
Entry
OLMES_2898        CDS       T04860                                 

Definition
(GenBank) RNA pseudouridine synthase family protein
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
ome  Oleiphilus messinensis
Brite
KEGG Orthology (KO) [BR:ome00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ome03016]
    OLMES_2898
Enzymes [BR:ome01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     OLMES_2898
Transfer RNA biogenesis [BR:ome03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    OLMES_2898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 DHBP_synthase
Motif
Other DBs
NCBI-ProteinID: ARU56943
UniProt: A0A1Y0IC36
Position
complement(3290418..3291188)
Genome map
AA seq 256 aa AA seqDB search
MLSTSHSRTSLPVIFQDESLIVINKPAGLLVHKSPIDRHEHQYAMKMVRDQIGQWVYPVH
RLDKPTSGVLVFALQPEIARELGLQFMSQSVKKRYLAVVRGFTALGGIIDHPIKETAMFK
SDKKKYEEKTAKDAVSLYHQLARLEVNEPIDRYPCARYSLLAVHPLSGRQHQIRRHLKHL
SHPLIGDAKYGKSIHNRFIADYFGVSRLLLHCHQMRFRHPTKREILFLEAPIDDDFRRIL
QVGSWETGTHLNSILT
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtacttcgcattcccggacatctcttccggttatttttcaagatgaaagcttg
attgtaattaataaacccgcagggcttttagttcataaaagcccgattgatcgccatgaa
catcaatacgcgatgaagatggttcgggatcagatagggcagtgggtatatccggttcac
cgtctcgataaacccacttcaggcgtgctggtttttgcgctccagccggaaattgcccgg
gaattagggcttcagtttatgagccaaagcgtaaagaagcggtacttggcggtggttcga
ggttttacagctcttgggggcatcatcgatcaccccattaaagaaaccgcaatgttcaag
agcgataaaaagaaatacgaagaaaagacagctaaagacgcagtgagtttgtaccaccaa
ttggcgcgccttgaagttaatgagccgattgatcgttacccctgtgctcgatactcactt
ctcgcggtacacccgctctctggtcgacagcaccagataagaaggcatttgaagcattta
tctcaccccttgattggtgatgcgaagtatgggaaaagtattcacaatcgcttcatagct
gactattttggcgttagcagattgcttttacattgtcatcaaatgcgtttcagacatccg
acaaaaagagaaattctctttctcgaagcgccgattgatgatgattttcggcgtatactc
caagtggggtcctgggaaaccggaacacacttgaattcgattttaacttaa

DBGET integrated database retrieval system