KEGG   Oleiphilus messinensis: OLMES_3521Help
Entry
OLMES_3521        CDS       T04860                                 

Gene name
rlmA
Definition
(GenBank) SAM-dependent 23S rRNA m(1)G745 methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ome  Oleiphilus messinensis
Brite
KEGG Orthology (KO) [BR:ome00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ome03009]
    OLMES_3521 (rlmA)
Enzymes [BR:ome01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     OLMES_3521 (rlmA)
Ribosome biogenesis [BR:ome03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    OLMES_3521 (rlmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_12 Methyltransf_11 Methyltransf_32 Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: ARU57551
UniProt: A0A1Y0IAQ7
Position
complement(4007252..4008151)
Genome map
AA seq 299 aa AA seqDB search
MSDPIHEPQSVNAEVFHSLLSCPICLCELSLKQRQLVCLNGHSFDQAKQGYFNLLPVQQK
KSRSPGDSKAMIAARRRFLQAGLYEPVATQVFNMVKSGHSEASQASDKGLVIADAGCGDG
YYLNFLSQALRAEGSAVVPVGWDISKEAIVAASKLDKHAIWLVASNKQPPITPERLDVLL
CLFGFPCYSAFKAVMRPGASLILVDPGPEHLIELRKVIYPTVKKSQVTSSDLAAESGFEL
ISTSHLTELLPAIDKAQIQDLLTMTPHLYKAPYEGKQAAQQLESITLTLDVTIRHYRVI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatccgatacacgagccacagtctgttaacgctgaggtgtttcattcgttgcta
tcttgcccgatttgtctttgtgaattgtcactcaagcagcgacagttggtgtgtttgaac
gggcattcttttgaccaggccaagcaggggtactttaacctgcttccggtacaacaaaag
aagtctcgaagcccgggtgacagtaaagcgatgattgcggctcgccggcgatttttgcag
gcaggcttgtatgaaccggtcgctacgcaagtctttaacatggtgaagtctggtcactca
gaggcttcgcaggcgagtgacaaaggtttggtgattgccgatgcaggatgtggcgacgga
tattatctgaattttctaagccaggcgctacgtgccgaagggagcgcagtggtgcctgtc
ggctgggatatctccaaggaagccattgttgccgcctccaaactggataaacacgctatt
tggctggtggcatccaacaagcagccccctatcactccagagcgtctggatgtgctgtta
tgtctgttcggcttcccgtgttattcggcgttcaaagcggtcatgcgcccgggagcatca
ctaatactggttgaccccggcccggaacatttaatcgagcttcgaaaggtgatttaccca
acggtgaaaaaaagtcaggtcacgtcgagcgatcttgcagcggaatcaggtttcgaattg
atttcgacctcgcatttaaccgaattattgcccgcaatcgataaagcgcagattcaagat
ttactgaccatgactccgcatttatacaaagcaccttatgaaggtaaacaagccgcgcaa
caactggagtcgataactttgacgctggatgtcacgatacgccactatcgggtaatttga

DBGET integrated database retrieval system