KEGG   Oleiphilus messinensis: OLMES_3572Help
Entry
OLMES_3572        CDS       T04860                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
ome  Oleiphilus messinensis
Pathway
ome00620  Pyruvate metabolism
ome01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ome00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OLMES_3572
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ome02000]
    OLMES_3572
Enzymes [BR:ome01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     OLMES_3572
Transporters [BR:ome02000]
 Other transporters
  Primary active transporters [TC:3]
   OLMES_3572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 ADH_zinc_N PTS_EIIA_1 TGT F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: ARU57602
UniProt: A0A1Y0IAP5
Position
complement(4061164..4062957)
Genome map
AA seq 597 aa AA seqDB search
MTDMKKPLGITDVVLRDAHQSLFATRLRLEDMLPIAAQLDSIGYWSVESWGGATFDSCIR
FIGEDPWERIRELKKAMPNTKQQMLLRGQNLLGYRHYADDVVNKFVERAAENGVDVFRVF
DAMNDPRNLDTALKAVKRVGKHAQGTISYTTSPVHTLDMWIDLAKEIEDMGADSIAIKDM
SGILTPSDAFDLVSRLKAQTSLEVQLHAHATSGLSDMTILKAVEAGIDRVDTAISSMSMT
YGHSATESVVAALKGTDRDTGLDISKLEEIAAYFRVVRKKYAKFEGSLRGTDSRILVAQV
PGGMLTNMEGQLKEQGAADKFDAVLEEIPRVREDLGYIPLVTPTSQIVGTQAVLNVLTGE
RYKSISKETAGILKGEYGAAPAPYNAELQARVLDGKEAITCRPADLLTPEMDKLTDEIKS
LSQEKGFKLADAVVDDALTYALFPQIGLKFLENRGDASAFEPAPTGNEVPASAASSKPGE
PETFTVSVSGQSYVVQVSEGGDVTHLAPVSGGASGGAAAPAALPAGGGDPINAPLAGNIF
KILVSAGQSVQEGDVLIILEAMKMETEIRAPKGGTVGGVQVAVGDSVAVGDVLLTLG
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgacagatatgaaaaaaccattaggtattactgatgttgtgcttcgggatgcacatcag
tcgctgttcgcgactcgcctgcgcctcgaagatatgcttcccattgccgcccagctcgat
agtattggatattggtcggtagaatcctggggtggcgcaacatttgactcctgcatccgc
tttatcggtgaagatccgtgggagcgtattcgcgagctgaaaaaagcaatgcccaacacc
aagcaacagatgttgctacgtggacagaatcttctgggttaccgacattatgcagatgat
gtagtcaataagtttgttgaacgtgctgcggaaaatggtgtagacgtattccgggtattc
gatgcgatgaatgatccacgaaacctggatacagcgctcaaagcagttaagcgcgttgga
aaacatgctcagggtaccatttcctacacgaccagccctgtacatactttggatatgtgg
atcgatctggccaaagaaatcgaagatatgggggcagactccatcgcgattaaagacatg
tcagggatcttgacgccgtctgatgcgtttgatctggtttcgcgactgaaagcacaaact
tcgttggaagttcaattgcacgctcatgcaacctccgggttgtctgatatgacgatcctt
aaagcggttgaagcgggaattgatcgcgttgatacggcaatttcttcaatgagtatgacc
tacggtcactcagcaacggaatctgttgttgcggcattgaaaggaaccgatcgagataca
ggtctggatatttccaaactggaagaaattgcagcctatttccgtgttgtgcgtaagaag
tacgccaagtttgaaggctccttgcgtggtacggattctcgaattctggttgctcaggtt
ccaggtggcatgttgaccaatatggaaggccagttgaaagagcaaggcgctgcagacaaa
tttgacgcagtgctggaagaaattccccgcgtacgtgaagacttgggttacatccctctg
gttacgccaacctctcaaatcgtgggtacacaagcggtacttaacgtcctgactggcgaa
cgttacaagtcaatttcaaaagaaaccgccggtattttaaaaggtgaatacggcgctgct
cctgcaccttacaatgctgagcttcaggctcgagtgctggatggcaaagaagcgatcact
tgtcgcccggctgacctgttaacgcctgaaatggataagttaacggatgaaatcaagtcc
ctgtcccaggaaaagggcttcaaattggctgatgctgttgtggacgatgcactgacttat
gccttgttcccacaaattggtttgaaattcctggaaaaccgaggtgatgcttccgcgttt
gagcctgctccaacaggaaatgaagtgcctgcatctgcggcatccagcaaaccgggtgag
ccagagactttcaccgtttctgttagcggccaatcctatgttgttcaggtttcagaaggt
ggtgatgttactcatttggctccagtttccggtggagccagtggtggggcagcggctcca
gcagcgcttcctgcaggtggtggtgatccaattaacgcgcctctcgctggtaatatcttc
aagattctcgtatctgcggggcagtcggttcaggaaggtgatgtactgattattcttgaa
gcgatgaaaatggaaaccgaaatccgtgcacccaagggcggtacggtaggtggtgttcaa
gttgctgttggcgattccgtcgctgttggtgatgtcctgttgactctgggttaa

DBGET integrated database retrieval system