KEGG   Oleiphilus messinensis: OLMES_4370Help
Entry
OLMES_4370        CDS       T04860                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ome  Oleiphilus messinensis
Pathway
ome00071  Fatty acid degradation
ome00072  Synthesis and degradation of ketone bodies
ome00280  Valine, leucine and isoleucine degradation
ome00310  Lysine degradation
ome00362  Benzoate degradation
ome00380  Tryptophan metabolism
ome00620  Pyruvate metabolism
ome00630  Glyoxylate and dicarboxylate metabolism
ome00640  Propanoate metabolism
ome00650  Butanoate metabolism
ome00900  Terpenoid backbone biosynthesis
ome01100  Metabolic pathways
ome01110  Biosynthesis of secondary metabolites
ome01120  Microbial metabolism in diverse environments
ome01130  Biosynthesis of antibiotics
ome01200  Carbon metabolism
ome01212  Fatty acid metabolism
ome02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ome00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OLMES_4370
   00630 Glyoxylate and dicarboxylate metabolism
    OLMES_4370
   00640 Propanoate metabolism
    OLMES_4370
   00650 Butanoate metabolism
    OLMES_4370
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OLMES_4370
   00072 Synthesis and degradation of ketone bodies
    OLMES_4370
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OLMES_4370
   00310 Lysine degradation
    OLMES_4370
   00380 Tryptophan metabolism
    OLMES_4370
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OLMES_4370
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OLMES_4370
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OLMES_4370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ome04147]
    OLMES_4370
Enzymes [BR:ome01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OLMES_4370
Exosome [BR:ome04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OLMES_4370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARU58367
UniProt: A0A1Y0ICX1
Position
complement(4959981..4961258)
Genome map
AA seq 425 aa AA seqDB search
MSTGIRKVAVIGGNRIPFTRSNTAYSSLSNQELLTSALRGLVDRYNLQGEKLGDVVAGAV
IKHSRDFNMTRESVLSSGLAPETPAYDIQQACGTGLEAAILVANKIALGQIDAGIAGGTD
TTSDAPIGLSDGLREILLDLNRARSNGERLKIISRFRPSQLIPLIPQNSEPRTGMSMGDH
CQVTAHEWKIPRDEQDQLAFESHQKLAAAYQNGFFEDLMTPIAGLSQDNTLRPDTSLEKL
STLKPCFDRENGTMTAGNSTALTDGASCVLMASEEWAKAKGLPIRAYFTHSEVAAVDFTG
KKEGLLMAPTYAVPRLLERAGLTLQDFDFYEIHEAFAAQVLSTLKAWEDETFCKEKLGLK
KALGSIDRSKLNVNGSSLATGHPFAATGGRIVATLAKLLEQKGSGRGLISICAAGGQGVT
AIMER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacaggaatacgaaaagtcgccgtgatcggtggcaacagaatcccatttacccga
tccaatacggcttattcatcgttgagtaatcaggagcttttgacttcagcgctacgtggt
ttggtggatcgctacaaccttcaaggcgaaaagttgggcgatgtggtagccggggcagta
atcaagcactcgcgggatttcaacatgactcgggagagcgtcttgagctcgggtctggct
ccggaaacacccgcttatgatatccagcaagcctgtggtacaggtctggaagccgcaatt
ctggttgcaaacaagatagcactggggcagattgacgcgggaatcgcgggcggaaccgat
acgacctccgacgctccgatcggactgagtgatggtctgcgggaaattttactggatttg
aaccgcgcgcgatccaacggtgaacgcctgaaaatcatctcccgcttccgtccttctcaa
cttattccgttgatcccgcaaaacagtgagccgcgcactggcatgtcaatgggtgaccat
tgtcaggttacggcccacgagtggaagattcctcgggatgagcaggatcaattagccttt
gaaagtcatcagaaattggctgcagcatatcaaaatggctttttcgaagacttgatgacg
ccgattgcgggcttgtcacaagacaatacccttcgccctgatacctctcttgaaaaactg
agcacattaaagccttgctttgatcgggaaaacgggacgatgacggcaggcaacagtact
gcacttaccgatggtgcatcctgtgtgctgatggcaagcgaagagtgggcaaaagcaaaa
ggcctgccgatccgcgcttacttcactcactctgaagtggccgctgtggactttaccggt
aagaaagaaggcctgctgatggcgccaacctatgcggttccccgtttgctggagcgtgca
ggtttgacccttcaggatttcgatttttacgaaatccacgaagcctttgcagcacaagtg
ctctccacattgaaagcatgggaagatgagaccttctgtaaagaaaaactgggtctcaag
aaagcgttgggctcaattgatcgtagcaaactcaacgtcaacggaagcagcctggcgaca
ggtcacccgtttgcggcgaccggtggacggattgtggcaacactcgcgaagctactggaa
caaaaaggttccggacgcggcctgatttctatctgtgctgcaggtggtcagggtgtgacg
gcaattatggaacgttaa

DBGET integrated database retrieval system