KEGG   Oleiphilus messinensis: OLMES_4806Help
Entry
OLMES_4806        CDS       T04860                                 

Definition
(GenBank) glutamine amidotransferase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
ome  Oleiphilus messinensis
Pathway
ome00230  Purine metabolism
ome01100  Metabolic pathways
Module
ome_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ome00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    OLMES_4806
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ome01002]
    OLMES_4806
Enzymes [BR:ome01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     OLMES_4806
Peptidases [BR:ome01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   OLMES_4806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 FAM110_C
Motif
Other DBs
NCBI-ProteinID: ARU58795
UniProt: A0A1Y0IGZ4
Position
complement(5467853..5468578)
Genome map
AA seq 241 aa AA seqDB search
MLLQIRDQESVRREEHESFCRYSGLEPEQVDVLNVFEEPHFSPERAGSYDAVFVGGASEA
NVMQPERYPFVMDCQRLLVFSLERDIPVFASCFGFQLAVLALGGEIVHQETDFEMGTIPI
EVSEGAVEDPLFRDTPQNFMAVSVHQQKATTIPVSCEILAFTSECVHAFRVKGKPFWAFQ
FHPEVDKRVLVERLTFYRDKYTANRDHLNQVLAKAVETPESNRLLHKFIRRVLLNATNEV
R
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttgctcttgcaaatacgagatcaggaaagcgttcgacgtgaggaacatgaaagcttctgt
cgttactccgggctagagccggaacaggtggatgtgctcaacgttttcgaggagcctcat
ttttcccccgaacgggcaggatcctatgatgccgtattcgtcgggggggccagtgaagcc
aatgtcatgcagccagagcgttatccttttgttatggattgccagcgcttgctggtattt
tctctggagcgtgatattccagtattcgcgtcctgctttggattccagcttgcagtattg
gcgctgggaggggaaatcgtccaccaggagacggatttcgaaatgggtacaatccccatt
gaagtctcggaaggtgcggtggaagacccactctttcgtgatacaccccaaaacttcatg
gcggtatcggtacatcagcaaaaagcgaccacgattccggtgtcctgtgaaatactggcc
tttacgtcggaatgcgttcatgcatttcgggtcaaaggcaagcctttctgggctttccag
tttcaccccgaagtcgataaacgtgtattggttgaacgattgacgttctatcgggataaa
tacactgccaatcgggatcacttgaatcaagttctggcgaaggccgtagagacgccggaa
tcgaatcgtctcctgcacaagtttattcgacgggtattgttaaatgcgactaatgaagtc
cgttag

DBGET integrated database retrieval system