KEGG   Oscillatoria nigro-viridis: Osc7112_0928Help
Entry
Osc7112_0928      CDS       T02375                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00010  Glycolysis / Gluconeogenesis
oni00052  Galactose metabolism
oni00500  Starch and sucrose metabolism
oni00520  Amino sugar and nucleotide sugar metabolism
oni00521  Streptomycin biosynthesis
oni01100  Metabolic pathways
oni01110  Biosynthesis of secondary metabolites
oni01120  Microbial metabolism in diverse environments
oni01130  Biosynthesis of antibiotics
oni01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Osc7112_0928
   00052 Galactose metabolism
    Osc7112_0928
   00500 Starch and sucrose metabolism
    Osc7112_0928
   00520 Amino sugar and nucleotide sugar metabolism
    Osc7112_0928
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Osc7112_0928
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Osc7112_0928
Enzymes [BR:oni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Osc7112_0928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFZ05495
UniProt: K9VE31
Position
complement(1072216..1073256)
Genome map
AA seq 346 aa AA seqDB search
MALLLAGDIGGTKTILRLVERTVNGEMNPLYEFRYPSGEFPDLVPMVQQFLTEAGTKLNL
TPQPEKACFAIAGPVVNNTAKLTNLPWMLDAKRLEQELGISRVSLINDFVAVGYGVWGLD
AKDLHILQVGKPRQHDPIAVIGAGTGLGNCFAIPEANGIKVFSSEGGHGDFAPRSELEFE
LLKYLLAKHDIQRISIERVVSGQGIVSIYQFLRDRKFAPESPEVGEVIKQWESEIGKSEK
SVDPGATIAQAALKKCDRLSEQTMQMFVEAYGAVAGNLAVTLLPYGGLYVAGGIAAKILP
LMLEGGFMRAFTHKGRMDSLLEMMPVRLVLNDNVGLIGAAVCAAGL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcattattattagcgggcgatattggcggaactaagacaattttgcgcttagtagaa
aggactgttaacggtgaaatgaaccctctttacgagtttcgctatccgagcggggagttt
cccgatttagtaccgatggtgcagcagtttttgacggaagctggtactaagttaaatttg
acaccacaacctgaaaaagcttgttttgcgatcgcaggcccggtggttaacaacactgca
aaactgactaatttgccttggatgctggatgcgaagcgtctggaacaagaattaggaata
tcccgcgtcagtttaattaatgattttgttgcggttggctacggcgtgtggggtttggat
gctaaagatttgcacattttgcaagtcggaaaaccccgccaacacgatccaattgctgtg
attggtgcggggactggtttgggaaattgttttgcaattcccgaggcaaatggcatcaag
gttttttcttcggaagggggacacggtgactttgctcctcgttcggagttggagtttgaa
ttgctgaaatatttgttagcaaaacacgacattcaaagaatatcgatcgagcgtgtagtt
tcgggacaagggattgtttcaatttaccagtttttgcgggacagaaagtttgctcctgaa
tcgccggaggtaggggaagttatcaaacaatgggagtcagaaatcggtaaaagcgagaag
agtgtcgatccgggggcgacaattgcacaggcggcactcaaaaagtgcgatcggctttcg
gaacaaacaatgcaaatgtttgtagaagcttacggtgcagtggcgggaaatctggctgtg
acactgttaccttacggcggtttgtacgtagctggcggcatcgctgctaaaattttgccg
ctgatgctagaagggggttttatgcgagcttttacccacaaaggccggatggattcgctg
ttagaaatgatgcctgttcgtcttgttttgaatgataatgtagggttaattggagccgca
gtttgtgcggccggtctttag

DBGET integrated database retrieval system