KEGG   Oscillatoria nigro-viridis: Osc7112_1283Help
Entry
Osc7112_1283      CDS       T02375                                 

Definition
(GenBank) glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00030  Pentose phosphate pathway
oni01100  Metabolic pathways
oni01120  Microbial metabolism in diverse environments
oni01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Osc7112_1283
Enzymes [BR:oni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     Osc7112_1283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Glyco_tran_WecB Epimerase THF_DHG_CYH_C DUF1940
Motif
Other DBs
NCBI-ProteinID: AFZ05826
UniProt: K9VD13
Position
1498623..1499435
Genome map
AA seq 270 aa AA seqDB search
MSYSPNLLKGQKALVTGASSGIGEAIARALAASGASVLVNYHSEQEAAEKIVSEIKSLGG
DAIAIGANVAKEEEVLSMFDQMYQHFGTIDILVNNAGLQKDSAFVDMTLDHWNLVIGVNL
TGQFLCAREAAKEFLKRGVKPHISSAAGKIICMSSVHEVIPWAGHVNYATSKGGIHMMMQ
SIAQELAPHRIRVNSIAPGAIKTPINKAAWDTPEAEAKLLKLIPAKRVGDVTDIAKAAVW
LASDDSDYVNGETLFVDGGMTLYPGFATGG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagctattcccctaatcttcttaaaggtcaaaaagcactggtaacgggtgcaagttcc
ggtattggtgaagcgatcgcccgtgctttggctgcatcgggtgcttctgttttagtcaac
taccattctgaacaggaagcagcagagaagattgtcagcgagattaaatcgctaggtggg
gacgcgatcgccattggtgcaaacgtcgccaaagaagaggaagttttatcgatgtttgac
caaatgtaccagcactttggcacgatcgacatcctcgtaaacaacgccggattgcaaaaa
gactcagcctttgtagacatgactctcgaccattggaatttggtgattggcgtgaaccta
accggacaatttctctgcgcccgcgaagcggcaaaagagtttctcaagcggggcgtgaag
ccacatatctccagtgccgcaggcaaaatcatttgtatgagttcggtacacgaggtaatt
ccttgggcgggtcacgtcaactacgctaccagtaagggcggcatccacatgatgatgcag
agtattgcccaagaactcgcaccgcacaggattcgggtcaacagcattgcacccggtgct
attaaaaccccaattaataaggcagcttgggacacgccagaagctgaggcaaaattacta
aaactcattcccgccaaacgggttggagatgtaacagacatcgctaaagctgctgtttgg
cttgcctcggatgactcagattatgtgaatggtgaaactttatttgtagacggcggcatg
actctgtatccagggtttgcgacggggggctag

DBGET integrated database retrieval system